(data stored in ACNUC16935 zone)

EMBL: BN001307.PE45

BN001307.PE45        Location/Qualifiers
FT   CDS             complement(join(120620..120834,121121..121301,
FT                   121545..121875,121929..122309,122363..122820))
FT                   /locus_tag="ANIA_09017"
FT                   /old_locus_tag="AN9017.4"
FT                   /product="Putative C2H2 finger domain transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007836"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007836"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007836"
FT                   /db_xref="GOA:Q5ARR3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR031348"
FT                   /db_xref="InterPro:IPR039327"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR3"
FT                   /protein_id="CBF84452.1"
FT                   /translation="MSGLEALGIAASIIQVADLGTKLSVKLFSFYKQFKDANESMHFLS
FT                   SEIAFVSAILRELGDTLKDEESSKLCSEEAFRSLKHTLDQCRDVLEQIQRVTSHTDRSG
FT                   KTRFQQVAGKFRMVLLEPSLDPLKNRLERLKSTMLLLLNVIMYAGQIRSSHGFPPLLQD
FT                   QRVLMDSLLKDKIKNGQEPRQFAVAEQCPKAPSVSTSSNGAHADIDGTIDTDEPAEFKE
FT                   YNLLIQKMLQEIGRCKYKLEESRHSRIKTGVLNIHSGEIMRFQLEYGHHVRTDHSLFTE
FT                   EKASRQMANVRKDENRPQRPIASTEATGANMPDNRTDGPPEVTVSSLTRESRRPSPRLA
FT                   KGKEPRESIFDLPLSPVPLAPVKEEEPVQSSNLTKETTALPTPYMFPATTVKSSAPIPG
FT                   AQQHNRPRRRYEEIERMYKCGWNGCEKTYGTLNQLNSHVTMQSHGAKRTAGEFKEIRKE
FT                   WKARKKEENAQRKAAEEYERAATQAALTSQVEPPGLFPDNLEDLLLRWTTLDRREICVE
FT                   VPAC"
     MSGLEALGIA ASIIQVADLG TKLSVKLFSF YKQFKDANES MHFLSSEIAF VSAILRELGD        60
     TLKDEESSKL CSEEAFRSLK HTLDQCRDVL EQIQRVTSHT DRSGKTRFQQ VAGKFRMVLL       120
     EPSLDPLKNR LERLKSTMLL LLNVIMYAGQ IRSSHGFPPL LQDQRVLMDS LLKDKIKNGQ       180
     EPRQFAVAEQ CPKAPSVSTS SNGAHADIDG TIDTDEPAEF KEYNLLIQKM LQEIGRCKYK       240
     LEESRHSRIK TGVLNIHSGE IMRFQLEYGH HVRTDHSLFT EEKASRQMAN VRKDENRPQR       300
     PIASTEATGA NMPDNRTDGP PEVTVSSLTR ESRRPSPRLA KGKEPRESIF DLPLSPVPLA       360
     PVKEEEPVQS SNLTKETTAL PTPYMFPATT VKSSAPIPGA QQHNRPRRRY EEIERMYKCG       420
     WNGCEKTYGT LNQLNSHVTM QSHGAKRTAG EFKEIRKEWK ARKKEENAQR KAAEEYERAA       480
     TQAALTSQVE PPGLFPDNLE DLLLRWTTLD RREICVEVPA C                           521
//

If you have problems or comments...

PBIL Back to PBIL home page