(data stored in ACNUC16935 zone)

EMBL: BN001307.PE452

BN001307.PE452       Location/Qualifiers
FT   CDS             complement(join(1259861..1259929,1260008..1260347,
FT                   1260417..1260585,1260675..1260816,1260880..1260945,
FT                   1261010..1261056,1261171..1261249))
FT                   /locus_tag="ANIA_09443"
FT                   /old_locus_tag="AN9443.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008236"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008236"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008236"
FT                   /db_xref="GOA:Q5AQI7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQI7"
FT                   /protein_id="CBF85197.1"
FT                   /translation="MEETRVNLLEYLRSKTQVDLDTFDITGISFPRLLEHTLNLETVAA
FT                   GLHDQFPEVTFDELGVEVGAVLLAGEMVPAFTGNLHLMVNPSYAYSREKVIEAAKSTPS
FT                   PISLYPVLPATWEGLQACRDLQAFKIKTLGTTLFSMEQAILAGEAGCVSISPFVHSLRI
FT                   LVDPEYKDPHPVYNLSAQAQRWYRRQSLPTKVKSCSTVGVDELLELAGIDALTIIPDDL
FT                   RALQSTYRDANQVFKLSIVENGTQNDDKIEHISYINDEEKYRADFQKADEGRAKAKTAE
FT                   AIDIFCGFQAKAEDVIRKAKGQ"
     MEETRVNLLE YLRSKTQVDL DTFDITGISF PRLLEHTLNL ETVAAGLHDQ FPEVTFDELG        60
     VEVGAVLLAG EMVPAFTGNL HLMVNPSYAY SREKVIEAAK STPSPISLYP VLPATWEGLQ       120
     ACRDLQAFKI KTLGTTLFSM EQAILAGEAG CVSISPFVHS LRILVDPEYK DPHPVYNLSA       180
     QAQRWYRRQS LPTKVKSCST VGVDELLELA GIDALTIIPD DLRALQSTYR DANQVFKLSI       240
     VENGTQNDDK IEHISYINDE EKYRADFQKA DEGRAKAKTA EAIDIFCGFQ AKAEDVIRKA       300
     KGQ                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page