(data stored in ACNUC16935 zone)

EMBL: BN001307.PE453

BN001307.PE453       Location/Qualifiers
FT   CDS             complement(join(1263264..1263505,1263560..1263645,
FT                   1263728..1264113,1264165..1264245,1264365..1264790))
FT                   /locus_tag="ANIA_09444"
FT                   /old_locus_tag="AN9444.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008237"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008237"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008237"
FT                   /db_xref="GOA:Q5AQI6"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQI6"
FT                   /protein_id="CBF85199.1"
FT                   /translation="MCGQYSPFPLVPPKLILLQAACVSTALRASSCDTGDTACLCTTAT
FT                   ALESALGCYSLQCTVKEALCKMTCPDYPRFPLLTSAASTNMTRSTCGLPEESEANLTPA
FT                   LAGSLGMLALIMVGLRIGWRTGTKKTVGWDDGFILLAMPDGAVKYHGLGTNLWTIPFDS
FT                   ITAQLKNQYLLIAEVFYMPAEAFTQLSFLAFYQRIFPPKYKYPIYTLSAISVCFGISNT
FT                   LIMIFQCTPVSFFWNSWTGEVSGTCININTYSWYRAAMQICMDVSIISLPIWPLSRLAL
FT                   STRKKAMVLVMFCTGFLSNNKTRITIVSCLRLQSLIKFSKSPNTSMDNNPAIYWSMVEC
FT                   DVAIICACMPSLPPLLKPIFPRCFATTQQSDPEEERTPQPVRLNQIMKKDEFSVLSSSA
FT                   SGDRLVA"
     MCGQYSPFPL VPPKLILLQA ACVSTALRAS SCDTGDTACL CTTATALESA LGCYSLQCTV        60
     KEALCKMTCP DYPRFPLLTS AASTNMTRST CGLPEESEAN LTPALAGSLG MLALIMVGLR       120
     IGWRTGTKKT VGWDDGFILL AMPDGAVKYH GLGTNLWTIP FDSITAQLKN QYLLIAEVFY       180
     MPAEAFTQLS FLAFYQRIFP PKYKYPIYTL SAISVCFGIS NTLIMIFQCT PVSFFWNSWT       240
     GEVSGTCINI NTYSWYRAAM QICMDVSIIS LPIWPLSRLA LSTRKKAMVL VMFCTGFLSN       300
     NKTRITIVSC LRLQSLIKFS KSPNTSMDNN PAIYWSMVEC DVAIICACMP SLPPLLKPIF       360
     PRCFATTQQS DPEEERTPQP VRLNQIMKKD EFSVLSSSAS GDRLVA                      406
//

If you have problems or comments...

PBIL Back to PBIL home page