(data stored in ACNUC16935 zone)

EMBL: BN001307.PE455

BN001307.PE455       Location/Qualifiers
FT   CDS             complement(1267940..1269013)
FT                   /locus_tag="ANIA_01602"
FT                   /old_locus_tag="AN1602.4"
FT                   /product="Putative endo-beta-1,4-glucanasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5BCX8]"
FT                   /note="transcript_id=CADANIAT00008239"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008239"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008239"
FT                   /db_xref="GOA:Q5BCX8"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR005103"
FT                   /db_xref="InterPro:IPR035971"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BCX8"
FT                   /protein_id="CBF85202.1"
FT                   /translation="MKFSSVLALAASAKLVASHATVFAVWINDEDQGLGNTADGYIRTP
FT                   PNNSPVTDVTSTDLTCNVNGDQAAAKTLEVAAGDKITFEWHHNSRDSSDDIIADSHKGP
FT                   VLVYMAPTEAGSAGKNWVKIYEDGYNDGTWAVDTLIANKGKHSVTVPDVPAGNYLFRPE
FT                   IIALHEGNREGGAQLYMECVQFKVTSDGTTQLPEGVSLPGAYTATDEGILFDIYSSFDS
FT                   YPIPGPAVWDGASSGSGSSGSGSSSSAAATSSAEKTATSTTAAATTTAVATSTSSATQV
FT                   QPTSVATFTTSVRPTTSAAPTTSAPTSSAAPTGGTGTGSIQIYQQCGGMNYKGATGCAS
FT                   GLTCKQWNPYYHQCVQA"
     MKFSSVLALA ASAKLVASHA TVFAVWINDE DQGLGNTADG YIRTPPNNSP VTDVTSTDLT        60
     CNVNGDQAAA KTLEVAAGDK ITFEWHHNSR DSSDDIIADS HKGPVLVYMA PTEAGSAGKN       120
     WVKIYEDGYN DGTWAVDTLI ANKGKHSVTV PDVPAGNYLF RPEIIALHEG NREGGAQLYM       180
     ECVQFKVTSD GTTQLPEGVS LPGAYTATDE GILFDIYSSF DSYPIPGPAV WDGASSGSGS       240
     SGSGSSSSAA ATSSAEKTAT STTAAATTTA VATSTSSATQ VQPTSVATFT TSVRPTTSAA       300
     PTTSAPTSSA APTGGTGTGS IQIYQQCGGM NYKGATGCAS GLTCKQWNPY YHQCVQA          357
//

If you have problems or comments...

PBIL Back to PBIL home page