(data stored in ACNUC16935 zone)

EMBL: BN001307.PE456

BN001307.PE456       Location/Qualifiers
FT   CDS             join(1271179..1271492,1271558..1271651)
FT                   /locus_tag="ANIA_01603"
FT                   /old_locus_tag="AN1603.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008240"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008240"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008240"
FT                   /db_xref="GOA:Q5BCX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX7"
FT                   /protein_id="CBF85204.1"
FT                   /translation="MTKELVSSSAANKALLNMFIAAELRYPVRQCAGARSVRRWEKTCG
FT                   SVGTQLPSALLLYPVAIGILVVCVTLTRIARIREIYKGKGLEIPDDFDSTLTMPPVHFM
FT                   QVSAPDDVDVNELRKVEVPGGLDIEILEFFE"
     MTKELVSSSA ANKALLNMFI AAELRYPVRQ CAGARSVRRW EKTCGSVGTQ LPSALLLYPV        60
     AIGILVVCVT LTRIARIREI YKGKGLEIPD DFDSTLTMPP VHFMQVSAPD DVDVNELRKV       120
     EVPGGLDIEI LEFFE                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page