(data stored in ACNUC16935 zone)

EMBL: BN001307.PE458

BN001307.PE458       Location/Qualifiers
FT   CDS             1275781..1276815
FT                   /locus_tag="ANIA_01605"
FT                   /old_locus_tag="AN1605.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008242"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008242"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008242"
FT                   /db_xref="GOA:Q5BCX5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX5"
FT                   /protein_id="CBF85208.1"
FT                   /translation="MERPAFLLPTATSHPTKPNTRIPPILAAGKATSLSPNSTTAAEPP
FT                   FSRIATISRQKLSAEAARGDPDLRRCLGHHRLLARSLYEAKQGMKRYLEEVLESESEDD
FT                   EDIYGEYEFGKGEVLLQEDELVDDEDDDDDDELYDDDLEDEDDDEDIDDECPTVEEEEV
FT                   VAPPASITVSPDPAADSAPAPNPDTSVKDQFSAPVPQSVPASMVPCSNSSTAPGPVWVK
FT                   EKIVGAVRGLVRRRNSTSLSPSPGPSPSTPPPTASPPEAASKSEAQSALAHMAANNASC
FT                   SQIPVYIHIHEHLSKPARRLERSQSQSQLQSRSQGHGRFITMRGRQYAQRLGLKVAAAV
FT                   PVTT"
     MERPAFLLPT ATSHPTKPNT RIPPILAAGK ATSLSPNSTT AAEPPFSRIA TISRQKLSAE        60
     AARGDPDLRR CLGHHRLLAR SLYEAKQGMK RYLEEVLESE SEDDEDIYGE YEFGKGEVLL       120
     QEDELVDDED DDDDDELYDD DLEDEDDDED IDDECPTVEE EEVVAPPASI TVSPDPAADS       180
     APAPNPDTSV KDQFSAPVPQ SVPASMVPCS NSSTAPGPVW VKEKIVGAVR GLVRRRNSTS       240
     LSPSPGPSPS TPPPTASPPE AASKSEAQSA LAHMAANNAS CSQIPVYIHI HEHLSKPARR       300
     LERSQSQSQL QSRSQGHGRF ITMRGRQYAQ RLGLKVAAAV PVTT                        344
//

If you have problems or comments...

PBIL Back to PBIL home page