(data stored in ACNUC16935 zone)

EMBL: BN001307.PE46

BN001307.PE46        Location/Qualifiers
FT   CDS             join(123129..123369,123441..123764,123832..123914)
FT                   /locus_tag="ANIA_11158"
FT                   /old_locus_tag="AN11158.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007837"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007837"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007837"
FT                   /db_xref="GOA:C8VKY4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKY4"
FT                   /protein_id="CBF84454.1"
FT                   /translation="MELLPTEILFDIVEHLCNRETKTLSLVSKRVRDVCLPVLFRKINI
FT                   EFSTEGFDLLESLLKSSIRRYIVSFQYIVPKLVKPQIRNYEIFRTEILTPGQYVEACEY
FT                   HDDVDSYEDWDEMEYVSGDQPSYTRMYKTIRRTCARQQEIIEARRDSTLMKLAFQQLSN
FT                   LKELVLVFSQAQGDEDWEEEYQEEYANLSKGFSSPVSNILPTLWWKAHIRTL"
     MELLPTEILF DIVEHLCNRE TKTLSLVSKR VRDVCLPVLF RKINIEFSTE GFDLLESLLK        60
     SSIRRYIVSF QYIVPKLVKP QIRNYEIFRT EILTPGQYVE ACEYHDDVDS YEDWDEMEYV       120
     SGDQPSYTRM YKTIRRTCAR QQEIIEARRD STLMKLAFQQ LSNLKELVLV FSQAQGDEDW       180
     EEEYQEEYAN LSKGFSSPVS NILPTLWWKA HIRTL                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page