(data stored in ACNUC16935 zone)

EMBL: BN001307.PE461

BN001307.PE461       Location/Qualifiers
FT   CDS             join(1289044..1289113,1289294..1289754)
FT                   /locus_tag="ANIA_01608"
FT                   /old_locus_tag="AN1608.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008245"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008245"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008245"
FT                   /db_xref="GOA:Q5BCX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX2"
FT                   /protein_id="CBF85213.1"
FT                   /translation="MSQFPTPIRLAQAVGLTGAAYLAGNIFAYSFATIPALESSQNKHG
FT                   APAALLAKQWSELYARGKAQNPPIAAATAAAFAYLAWSVHSGKSAALQVLAPANAAYLY
FT                   SAAAALTVGIVPWTLFAMTKTNDALHERAKEVFVVTEKTADEVKELLAKWKVLNAIRGL
FT                   LPLVGGLVGFLAF"
     MSQFPTPIRL AQAVGLTGAA YLAGNIFAYS FATIPALESS QNKHGAPAAL LAKQWSELYA        60
     RGKAQNPPIA AATAAAFAYL AWSVHSGKSA ALQVLAPANA AYLYSAAAAL TVGIVPWTLF       120
     AMTKTNDALH ERAKEVFVVT EKTADEVKEL LAKWKVLNAI RGLLPLVGGL VGFLAF           176
//

If you have problems or comments...

PBIL Back to PBIL home page