(data stored in ACNUC16935 zone)

EMBL: BN001307.PE462

BN001307.PE462       Location/Qualifiers
FT   CDS             join(1290047..1290512,1290707..1290828,1290876..1291153,
FT                   1291379..1291523,1291859..1292208,1292356..1292576,
FT                   1292626..1292738)
FT                   /locus_tag="ANIA_01609"
FT                   /old_locus_tag="AN1609.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008246"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008246"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008246"
FT                   /db_xref="GOA:Q5BCX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX1"
FT                   /protein_id="CBF85215.1"
FT                   /translation="MLVPIRVHIRDPLILLRRRKRLHRVRHLARGYSHRKNQTAAIAPR
FT                   TSGMPTPNPTPRPTPRLLSELLSLPLPPVGVVVGVEVVVTVLVVVTEVEVDELLVLSGE
FT                   RLLTTNSTAGIENVWVELLQSHPPYAVQQNVSVPQAVTRFRNLKPSTSPRLTLRWVAAL
FT                   RASNARYILVAVAVVALGYHFGADRARSAGNGTIFSRDECEDGKSVDRETLWSTGDCLK
FT                   NEIKNPKKSRSEAKGRLSVGSLDEDLRPKDARKLKFWQDAVRNQSPGNRNIASWRLQAS
FT                   PNRTSDNLFSAEVTEGTPYNYTAPCQGLKATLVLHRASLNSATQGLHLVPDNAESCSGY
FT                   GKVEQWDVDAYSCQGQAYLDTSIANRTTHLKLASSDISSAMRIHHKQQYPLQLYAAGSA
FT                   SQTPTSSLLAIKSKILLNKRSKVHRSGRKSSRHWIHRSAYSNGQRCSSSHHFGLRRVCL
FT                   FATHGDPDMIMTAAEGRLPTARVVAAIYLLFSTDHVPAPGGEIVICNTFPSYSLVIFRR
FT                   MARRTGYNGLAFKDAREKKESRSKAWVMELLKGQSARGDWTKSLRSR"
     MLVPIRVHIR DPLILLRRRK RLHRVRHLAR GYSHRKNQTA AIAPRTSGMP TPNPTPRPTP        60
     RLLSELLSLP LPPVGVVVGV EVVVTVLVVV TEVEVDELLV LSGERLLTTN STAGIENVWV       120
     ELLQSHPPYA VQQNVSVPQA VTRFRNLKPS TSPRLTLRWV AALRASNARY ILVAVAVVAL       180
     GYHFGADRAR SAGNGTIFSR DECEDGKSVD RETLWSTGDC LKNEIKNPKK SRSEAKGRLS       240
     VGSLDEDLRP KDARKLKFWQ DAVRNQSPGN RNIASWRLQA SPNRTSDNLF SAEVTEGTPY       300
     NYTAPCQGLK ATLVLHRASL NSATQGLHLV PDNAESCSGY GKVEQWDVDA YSCQGQAYLD       360
     TSIANRTTHL KLASSDISSA MRIHHKQQYP LQLYAAGSAS QTPTSSLLAI KSKILLNKRS       420
     KVHRSGRKSS RHWIHRSAYS NGQRCSSSHH FGLRRVCLFA THGDPDMIMT AAEGRLPTAR       480
     VVAAIYLLFS TDHVPAPGGE IVICNTFPSY SLVIFRRMAR RTGYNGLAFK DAREKKESRS       540
     KAWVMELLKG QSARGDWTKS LRSR                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page