(data stored in ACNUC16935 zone)

EMBL: BN001307.PE463

BN001307.PE463       Location/Qualifiers
FT   CDS             join(1295333..1295370,1295449..1296442)
FT                   /locus_tag="ANIA_01610"
FT                   /old_locus_tag="AN1610.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008247"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008247"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008247"
FT                   /db_xref="GOA:C8VNA7"
FT                   /db_xref="UniProtKB/TrEMBL:C8VNA7"
FT                   /protein_id="CBF85217.1"
FT                   /translation="MSRSKDSLDSTSSRISKSQLFPLAHPPPKSKSAPNKSPRLRLSSR
FT                   LVLQIQQSSQSRAIPILELYQPSTFGKSIALPDGSRKVHGRDMYVTQSEMYTHLKRPRK
FT                   RDAVDGYGTGYGHGYGNAYGHTTKPRSGSGGSRSVSGSAYSSAASSRPKSRSSGASSGD
FT                   EGQGECKAKFRARRKSGNDADGEQDDVVAMIHTSPKSTAADAQLFFPQNNQTWETTSSR
FT                   PGYYRFQSDGSSVVFEWEKRPPSRSHPSSAAENDDGERFVLSVSVSEPTSSHTKRPWLA
FT                   QLSKRGVHVGGLEPWRDEPGLRALIDGVGDGAGAGGSGAGAGLYTLILTMGVWVAKGEG
FT                   WVN"
     MSRSKDSLDS TSSRISKSQL FPLAHPPPKS KSAPNKSPRL RLSSRLVLQI QQSSQSRAIP        60
     ILELYQPSTF GKSIALPDGS RKVHGRDMYV TQSEMYTHLK RPRKRDAVDG YGTGYGHGYG       120
     NAYGHTTKPR SGSGGSRSVS GSAYSSAASS RPKSRSSGAS SGDEGQGECK AKFRARRKSG       180
     NDADGEQDDV VAMIHTSPKS TAADAQLFFP QNNQTWETTS SRPGYYRFQS DGSSVVFEWE       240
     KRPPSRSHPS SAAENDDGER FVLSVSVSEP TSSHTKRPWL AQLSKRGVHV GGLEPWRDEP       300
     GLRALIDGVG DGAGAGGSGA GAGLYTLILT MGVWVAKGEG WVN                         343
//

If you have problems or comments...

PBIL Back to PBIL home page