(data stored in ACNUC16935 zone)

EMBL: BN001307.PE464

BN001307.PE464       Location/Qualifiers
FT   CDS             complement(1296544..1298433)
FT                   /locus_tag="ANIA_01611"
FT                   /old_locus_tag="AN1611.4"
FT                   /product="flavin-binding monooxygenase-like protein
FT                   (AFU_orthologue; AFUA_4G09220)"
FT                   /note="transcript_id=CADANIAT00008248"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008248"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008248"
FT                   /db_xref="GOA:Q5BCW9"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW9"
FT                   /protein_id="CBF85220.1"
FT                   /translation="MSAAKIEPGSFNIPVGTFPATCKTPQESINAHALATSILSRLNTA
FT                   LSTSKISDIAALFLEQGSFWRDHLCLSWNFHTAKGREGIASLLSQVEKEKLNHLKLEID
FT                   ISTPFRSPQISAIDAFGEVIGVQFFITVSTAIGSGRGVVRLAEGDEGEWYIYTLYTVLQ
FT                   ELTGHEEQVSSRRPFGAVHGEISGRPRLNWQDRRKAETNLDENKEPAVLIVGAGQAGLS
FT                   VAARLRMLGVDALIIDQEDRVGDNWRRRYHQLVLHDPVWFDHMPYLPFPSNWPVFTPKD
FT                   KLAEFFECYVKLLELNVWTRTTVKEAKWHADGKEWSVEVIRRTDSGEVKRVLHPRHIIQ
FT                   ATGHSGEKNLPEFKGIESFKGSRICHSSEFEGATDADPRKGQQKAVVVGSCNSAHDIAQ
FT                   DYYEKGYDVTMVQRSSTCVISSDAIVNIGLKGLYEENGPPVHDSDVFLYSIPSEQFKAQ
FT                   QVRITAVQNEHDKVLLEGLEKAGFKVDKGPDDAGLLMKYWQRGGGYTIEVGAGRLIADG
FT                   KIKVKQGEEIAEILPQGLRFADGSELEADEIVFATGYKNMREQTRLIFGDMVANSVNSV
FT                   WGLDSEGEMRTIWRKTGHPGFWFMGGNLAMCRYYSLLLALQILGIERGLNEVQ"
     MSAAKIEPGS FNIPVGTFPA TCKTPQESIN AHALATSILS RLNTALSTSK ISDIAALFLE        60
     QGSFWRDHLC LSWNFHTAKG REGIASLLSQ VEKEKLNHLK LEIDISTPFR SPQISAIDAF       120
     GEVIGVQFFI TVSTAIGSGR GVVRLAEGDE GEWYIYTLYT VLQELTGHEE QVSSRRPFGA       180
     VHGEISGRPR LNWQDRRKAE TNLDENKEPA VLIVGAGQAG LSVAARLRML GVDALIIDQE       240
     DRVGDNWRRR YHQLVLHDPV WFDHMPYLPF PSNWPVFTPK DKLAEFFECY VKLLELNVWT       300
     RTTVKEAKWH ADGKEWSVEV IRRTDSGEVK RVLHPRHIIQ ATGHSGEKNL PEFKGIESFK       360
     GSRICHSSEF EGATDADPRK GQQKAVVVGS CNSAHDIAQD YYEKGYDVTM VQRSSTCVIS       420
     SDAIVNIGLK GLYEENGPPV HDSDVFLYSI PSEQFKAQQV RITAVQNEHD KVLLEGLEKA       480
     GFKVDKGPDD AGLLMKYWQR GGGYTIEVGA GRLIADGKIK VKQGEEIAEI LPQGLRFADG       540
     SELEADEIVF ATGYKNMREQ TRLIFGDMVA NSVNSVWGLD SEGEMRTIWR KTGHPGFWFM       600
     GGNLAMCRYY SLLLALQILG IERGLNEVQ                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page