(data stored in ACNUC16935 zone)

EMBL: BN001307.PE466

BN001307.PE466       Location/Qualifiers
FT   CDS             complement(join(1303118..1303161,1303237..1303413,
FT                   1303444..1303812,1303908..1304041,1304105..1304391))
FT                   /locus_tag="ANIA_01613"
FT                   /old_locus_tag="AN1613.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008250"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008250"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW7"
FT                   /protein_id="CBF85223.1"
FT                   /translation="MIPYSHEHLQDRPFPASARRESTATVSSTPSTATSSRSSVSGSLC
FT                   FVSEPPFSPSLSPSLFPSPSTSASVSLASRPREGSLNDEVARLPLNPAVTVSFVRSSRL
FT                   FKLRYTFINIRKDFAGALKCLELGGAVGQQTAFLHSFNTTRLPVPHLEHPITSSEPYTP
FT                   SSLRISFLDEQTVQTGATVFATQLSYTFESWLDCLQFQELILASRIVFIAGIAEAKSKG
FT                   RGEECISQNLRILRQDHTGKLVMLFFANSQRKERKRYVSIPLNHIHYGLRADYSRWHLV
FT                   SCIESVMPGKNSRRPVVLQLQPNFDHLAQMRTLQISFLDSDDKKAFCEFLAANNR"
     MIPYSHEHLQ DRPFPASARR ESTATVSSTP STATSSRSSV SGSLCFVSEP PFSPSLSPSL        60
     FPSPSTSASV SLASRPREGS LNDEVARLPL NPAVTVSFVR SSRLFKLRYT FINIRKDFAG       120
     ALKCLELGGA VGQQTAFLHS FNTTRLPVPH LEHPITSSEP YTPSSLRISF LDEQTVQTGA       180
     TVFATQLSYT FESWLDCLQF QELILASRIV FIAGIAEAKS KGRGEECISQ NLRILRQDHT       240
     GKLVMLFFAN SQRKERKRYV SIPLNHIHYG LRADYSRWHL VSCIESVMPG KNSRRPVVLQ       300
     LQPNFDHLAQ MRTLQISFLD SDDKKAFCEF LAANNR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page