(data stored in ACNUC16935 zone)

EMBL: BN001307.PE468

BN001307.PE468       Location/Qualifiers
FT   CDS             complement(join(1309778..1309830,1309891..1310009,
FT                   1310177..1310197,1310253..1310481,1310876..1310923,
FT                   1311189..1311285,1311367..1311421,1311481..1312769))
FT                   /locus_tag="ANIA_01615"
FT                   /old_locus_tag="AN1615.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008252"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008252"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008252"
FT                   /db_xref="GOA:Q5BCW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW5"
FT                   /protein_id="CBF85226.1"
FT                   /translation="MSSTLSTPSLSQFPTPNQTPRLPTPPNSPEETHPHIMSAEENEIL
FT                   AQESTRLTESGDDFAPTITSLLNEYTDRMKQIQRRRLAEQKGEHEILYAKLRRQKDSAL
FT                   SGLKQAQDLTTRYKQELDAKVIEEEQLTEKMKTLEKLLAETATQLSDTTKAYAEKEEIW
FT                   NSVMGPLARLENDNNEIREQLGEIKQQLEGTNASIAEERAISDRNLSELASVRDKLAEE
FT                   KVQRAAVERRLNEQDDRVRLLSNRIIYLKASKLQLRSELNQARREAEQVNRLRSANEEL
FT                   GARCETLTRDVSDLRDVRHHHEDEIRRMKQQQDTMTGAIHHLTSEVQVEQKRSEQLQSS
FT                   VSDLEQKRDGLNNQLQHLQGEYNDLTGALANAHEAARRAEICMQWVVIAHRARCRSLKA
FT                   EVAELKSSRLPKVEAKRSLANIRRGNSPARLGVVERPPVTIRKPRWKNQTVNSITTSAA
FT                   AYLFWLCKTTGLRSALYALTTSCNHEEIKARCQPGMIQIYQLYPNSKIGATQLKKRLAN
FT                   VGLPKDHDYSRPTSEVTDTKVLVEVHEDRAQEQAQQPAAIPSQFQPEHNNICKATGRIL
FT                   TVRHPRRIQERVAQKDDLGIPSAVLPAHGPSQSCSLGIRVGRRPSYYLRTFGQKPDRGV
FT                   L"
     MSSTLSTPSL SQFPTPNQTP RLPTPPNSPE ETHPHIMSAE ENEILAQEST RLTESGDDFA        60
     PTITSLLNEY TDRMKQIQRR RLAEQKGEHE ILYAKLRRQK DSALSGLKQA QDLTTRYKQE       120
     LDAKVIEEEQ LTEKMKTLEK LLAETATQLS DTTKAYAEKE EIWNSVMGPL ARLENDNNEI       180
     REQLGEIKQQ LEGTNASIAE ERAISDRNLS ELASVRDKLA EEKVQRAAVE RRLNEQDDRV       240
     RLLSNRIIYL KASKLQLRSE LNQARREAEQ VNRLRSANEE LGARCETLTR DVSDLRDVRH       300
     HHEDEIRRMK QQQDTMTGAI HHLTSEVQVE QKRSEQLQSS VSDLEQKRDG LNNQLQHLQG       360
     EYNDLTGALA NAHEAARRAE ICMQWVVIAH RARCRSLKAE VAELKSSRLP KVEAKRSLAN       420
     IRRGNSPARL GVVERPPVTI RKPRWKNQTV NSITTSAAAY LFWLCKTTGL RSALYALTTS       480
     CNHEEIKARC QPGMIQIYQL YPNSKIGATQ LKKRLANVGL PKDHDYSRPT SEVTDTKVLV       540
     EVHEDRAQEQ AQQPAAIPSQ FQPEHNNICK ATGRILTVRH PRRIQERVAQ KDDLGIPSAV       600
     LPAHGPSQSC SLGIRVGRRP SYYLRTFGQK PDRGVL                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page