(data stored in ACNUC16935 zone)

EMBL: BN001307.PE469

BN001307.PE469       Location/Qualifiers
FT   CDS             join(1315711..1315835,1315913..1315999,1316056..1316136,
FT                   1316202..1317123)
FT                   /locus_tag="ANIA_01616"
FT                   /old_locus_tag="AN1616.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008253"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008253"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008253"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW4"
FT                   /protein_id="CBF85228.1"
FT                   /translation="MSMFPPAPKPPTLLGYHRVLSPSAGVKVSPLCLGAMNFGDAWKEY
FT                   MGECNKEQTFALLDAFYEAGGNFIDTANNYQQEESEKWIGEWLKKRGNRDQMVIATKYT
FT                   TGFRTSHRATEPLQSNFVGNSFKSMRVSVDNSLRKLQTDYIDILYLHWWDFTTSVEEVM
FT                   HGLNSLVTAGKVLYLGVSDTPAWVVVKANDYARAHGLKPFSVYQGKWNAAYRDMEREIV
FT                   PMCRDQGMGIAPWAPLGGGKFKSAEARKAASSGGSNRGAEMSESDIRISDALEKIAERK
FT                   KTTLHAIVSHPCQYPYLYSITDQCPCQALAYVMHKTPNVFPIVGQRKIEHLKANIEALS
FT                   ISLSDADMDEIDGATEFDVGFPMSFIFREFTGRNTAADVWLTKASALIDAPPQPGPVRH
FT                   REAER"
     MSMFPPAPKP PTLLGYHRVL SPSAGVKVSP LCLGAMNFGD AWKEYMGECN KEQTFALLDA        60
     FYEAGGNFID TANNYQQEES EKWIGEWLKK RGNRDQMVIA TKYTTGFRTS HRATEPLQSN       120
     FVGNSFKSMR VSVDNSLRKL QTDYIDILYL HWWDFTTSVE EVMHGLNSLV TAGKVLYLGV       180
     SDTPAWVVVK ANDYARAHGL KPFSVYQGKW NAAYRDMERE IVPMCRDQGM GIAPWAPLGG       240
     GKFKSAEARK AASSGGSNRG AEMSESDIRI SDALEKIAER KKTTLHAIVS HPCQYPYLYS       300
     ITDQCPCQAL AYVMHKTPNV FPIVGQRKIE HLKANIEALS ISLSDADMDE IDGATEFDVG       360
     FPMSFIFREF TGRNTAADVW LTKASALIDA PPQPGPVRHR EAER                        404
//

If you have problems or comments...

PBIL Back to PBIL home page