(data stored in ACNUC16935 zone)

EMBL: BN001307.PE47

BN001307.PE47        Location/Qualifiers
FT   CDS             124831..125619
FT                   /locus_tag="ANIA_11160"
FT                   /old_locus_tag="AN11160.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007838"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007838"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007838"
FT                   /db_xref="GOA:C8VKY5"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKY5"
FT                   /protein_id="CBF84456.1"
FT                   /translation="MANNTTPNLVVLVDADNAMPSTARLILAEVAKYGTVYVKRAYGDW
FT                   TSTSLKGWKKELLSQSIQPFQQFAYTNGKNSTDSAMIIDAMDLLYSNRFGGFCLVSSDS
FT                   DFTRLAARIRESGLTVYGFGEQKTPKPFVAACNKFIYTENLSFHGELVPHPDRVIVPKN
FT                   HVPARHAHADGHLKTLLHTTIETASDDDGWAELSNVGTLLTKKHPDFDSRTYGYNKLGD
FT                   LISALSLFDVVRQLPRKGKAGKIYVRDKRRGRKDSAASST"
     MANNTTPNLV VLVDADNAMP STARLILAEV AKYGTVYVKR AYGDWTSTSL KGWKKELLSQ        60
     SIQPFQQFAY TNGKNSTDSA MIIDAMDLLY SNRFGGFCLV SSDSDFTRLA ARIRESGLTV       120
     YGFGEQKTPK PFVAACNKFI YTENLSFHGE LVPHPDRVIV PKNHVPARHA HADGHLKTLL       180
     HTTIETASDD DGWAELSNVG TLLTKKHPDF DSRTYGYNKL GDLISALSLF DVVRQLPRKG       240
     KAGKIYVRDK RRGRKDSAAS ST                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page