(data stored in ACNUC16935 zone)

EMBL: BN001307.PE470

BN001307.PE470       Location/Qualifiers
FT   CDS             join(1317958..1318071,1318373..1318621)
FT                   /locus_tag="ANIA_01617"
FT                   /old_locus_tag="AN1617.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008254"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008254"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008254"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW3"
FT                   /protein_id="CBF85230.1"
FT                   /translation="MTFGTANSGTYGHCKKDDAFGMLDAFYSKGGNFIDTAIGISDTPA
FT                   WVVSKANEYARQKGPRQFVVYQGMWNATMRDFERDIIPMCREEGMGLCPYGVLNQGRFQ
FT                   TEEGFRSVKNTTRGGI"
     MTFGTANSGT YGHCKKDDAF GMLDAFYSKG GNFIDTAIGI SDTPAWVVSK ANEYARQKGP        60
     RQFVVYQGMW NATMRDFERD IIPMCREEGM GLCPYGVLNQ GRFQTEEGFR SVKNTTRGGI       120
//

If you have problems or comments...

PBIL Back to PBIL home page