(data stored in ACNUC16935 zone)

EMBL: BN001307.PE471

BN001307.PE471       Location/Qualifiers
FT   CDS             complement(join(1320046..1320222,1320296..1320454,
FT                   1320520..1320576))
FT                   /locus_tag="ANIA_01618"
FT                   /old_locus_tag="AN1618.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008255"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008255"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008255"
FT                   /db_xref="GOA:Q5BCW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW2"
FT                   /protein_id="CBF85232.1"
FT                   /translation="MFSPLTLAILAICIAVSSSLTVGCYPEDYQIVQNDLFDGLYSLKN
FT                   DQISNLQPGTCERVVCNSNAAVYWCNDNEDRHAEVKSKQVGDAAWKIIHDCGISAHTLI
FT                   YAAGVVVYPTKIRVVVIKDDECLDQH"
     MFSPLTLAIL AICIAVSSSL TVGCYPEDYQ IVQNDLFDGL YSLKNDQISN LQPGTCERVV        60
     CNSNAAVYWC NDNEDRHAEV KSKQVGDAAW KIIHDCGISA HTLIYAAGVV VYPTKIRVVV       120
     IKDDECLDQH                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page