(data stored in ACNUC16935 zone)

EMBL: BN001307.PE472

BN001307.PE472       Location/Qualifiers
FT   CDS             join(1322448..1322900,1322957..1323094,1323152..1323930,
FT                   1323984..1324119)
FT                   /locus_tag="ANIA_01619"
FT                   /old_locus_tag="AN1619.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008256"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008256"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008256"
FT                   /db_xref="GOA:Q5BCW1"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW1"
FT                   /protein_id="CBF85234.1"
FT                   /translation="MLAAQFARTPGRRVMTKLSSQNPILRPASFLINQHNSTRKRAMSS
FT                   QPSATRTRALVDWASALQFTDLPPAVIARTKDFFVDTLACAVAGREHIAVKSMLEYSKI
FT                   MGPADGKCELIGFPDVKTTPAFAALVNGGAAHVVEQDDLHNSSMMHPATIIYPTALAVA
FT                   QDVGATGRDFITACVVGYEFACRAGEYLGKAHYEKFHTTATTGVLGAAATTAYLLRLDS
FT                   DQFLSSIGTAGTQAAGLWQFLLDATHSKQVHTAQACAAGVFSAYTSASGLLGTSDILEG
FT                   ERGMGATLGNLTTTPEAIDRDLGRKWSVLESSFKWHASCRHTHPSADALIALMHDENVK
FT                   YTDIESVTAYTYKAALDVLGLSGEGKTVHQSKFSMGFVLAVAAKKGTAGLTDFTEEALK
FT                   DPELRELQGRVKMVLDEEIDAAFPEKWLGRVVVQTKDGRTLSRTVDVVKGDPGWTLTRE
FT                   EIESKALALAEYGRVKDLNAFKDAIQRIWRLEEQDKINRFSFS"
     MLAAQFARTP GRRVMTKLSS QNPILRPASF LINQHNSTRK RAMSSQPSAT RTRALVDWAS        60
     ALQFTDLPPA VIARTKDFFV DTLACAVAGR EHIAVKSMLE YSKIMGPADG KCELIGFPDV       120
     KTTPAFAALV NGGAAHVVEQ DDLHNSSMMH PATIIYPTAL AVAQDVGATG RDFITACVVG       180
     YEFACRAGEY LGKAHYEKFH TTATTGVLGA AATTAYLLRL DSDQFLSSIG TAGTQAAGLW       240
     QFLLDATHSK QVHTAQACAA GVFSAYTSAS GLLGTSDILE GERGMGATLG NLTTTPEAID       300
     RDLGRKWSVL ESSFKWHASC RHTHPSADAL IALMHDENVK YTDIESVTAY TYKAALDVLG       360
     LSGEGKTVHQ SKFSMGFVLA VAAKKGTAGL TDFTEEALKD PELRELQGRV KMVLDEEIDA       420
     AFPEKWLGRV VVQTKDGRTL SRTVDVVKGD PGWTLTREEI ESKALALAEY GRVKDLNAFK       480
     DAIQRIWRLE EQDKINRFSF S                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page