(data stored in ACNUC16935 zone)

EMBL: BN001307.PE48

BN001307.PE48        Location/Qualifiers
FT   CDS             complement(join(126351..126393,126452..127103,
FT                   127161..127504,127568..127677,127736..128291,
FT                   128337..128554))
FT                   /locus_tag="ANIA_09015"
FT                   /old_locus_tag="AN9015.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007839"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007839"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007839"
FT                   /db_xref="GOA:Q5ARR5"
FT                   /db_xref="InterPro:IPR021842"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR5"
FT                   /protein_id="CBF84458.1"
FT                   /translation="MAWSASFRVCPICLALFLTLEKMIADNLQKALADRIARAKSRGFT
FT                   LEYQNEQEQQENVICRRELAPATFNKYEFSLKALTAARWRLSRNEPQNANFSKDDPDPS
FT                   PQLLKLFVEDYIVTREHTPTQKTACSILICFVSRWERETSRSMPEAVKEDVLNVRHPLF
FT                   LLLSFITDRSKHIRTALTTKYGLPTRPRERFLVTAKDIELLLRHLFVNDTHDYVHERAR
FT                   VQTGTGLSLFAGSGARAGAIVESSSYRGTNECLYYRHLSFHLKWSRKGDGLKRWVTIDP
FT                   EFLKGWRYRDDVTLPKNWLREHPVLGMNFVFWVIVHGVADGAFKGLPTVANVLAAKPPE
FT                   GRESWTLEWSDKAKDLPFFRMVTPEGPHATRALTFSSLHHNFTSLAQRDCFKDQLRVHG
FT                   IRGGVANLIDPKASEATRGQALDHQNHETYLKYQSVLKALDIQSLFYDLEPEYECRDME
FT                   QSMAHHRDTNVPQKLDAAAIAEFEAQDEIVKINRRIAVLTAEIAGNPRGHEDLVSERAR
FT                   LYTKKAKRRRAWKAEFIRRWWDSSYDEYISGNNFAERDTTPLFGIYKKYLPERARLSEN
FT                   LFRETPLDSDIGRQCLEDMVALCKSTERVVYYPDMSPVSGCCPTCSKPMSGGRQSTFYN
FT                   VEEAL"
     MAWSASFRVC PICLALFLTL EKMIADNLQK ALADRIARAK SRGFTLEYQN EQEQQENVIC        60
     RRELAPATFN KYEFSLKALT AARWRLSRNE PQNANFSKDD PDPSPQLLKL FVEDYIVTRE       120
     HTPTQKTACS ILICFVSRWE RETSRSMPEA VKEDVLNVRH PLFLLLSFIT DRSKHIRTAL       180
     TTKYGLPTRP RERFLVTAKD IELLLRHLFV NDTHDYVHER ARVQTGTGLS LFAGSGARAG       240
     AIVESSSYRG TNECLYYRHL SFHLKWSRKG DGLKRWVTID PEFLKGWRYR DDVTLPKNWL       300
     REHPVLGMNF VFWVIVHGVA DGAFKGLPTV ANVLAAKPPE GRESWTLEWS DKAKDLPFFR       360
     MVTPEGPHAT RALTFSSLHH NFTSLAQRDC FKDQLRVHGI RGGVANLIDP KASEATRGQA       420
     LDHQNHETYL KYQSVLKALD IQSLFYDLEP EYECRDMEQS MAHHRDTNVP QKLDAAAIAE       480
     FEAQDEIVKI NRRIAVLTAE IAGNPRGHED LVSERARLYT KKAKRRRAWK AEFIRRWWDS       540
     SYDEYISGNN FAERDTTPLF GIYKKYLPER ARLSENLFRE TPLDSDIGRQ CLEDMVALCK       600
     STERVVYYPD MSPVSGCCPT CSKPMSGGRQ STFYNVEEAL                             640
//

If you have problems or comments...

PBIL Back to PBIL home page