(data stored in ACNUC16935 zone)

EMBL: BN001307.PE49

BN001307.PE49        Location/Qualifiers
FT   CDS             complement(join(129134..129209,129265..129341,
FT                   129409..129764,129992..130226,130280..130420,
FT                   130475..130561))
FT                   /locus_tag="ANIA_09014"
FT                   /old_locus_tag="AN9014.4"
FT                   /product="FMN-dependent dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_8G02300)"
FT                   /note="transcript_id=CADANIAT00007840"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007840"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007840"
FT                   /db_xref="GOA:Q5ARR6"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR6"
FT                   /protein_id="CBF84460.1"
FT                   /translation="MAHRGESFHKDVSCIADLKALGSSRLPATSDYYNEGAMDLITLRD
FT                   NEAAFDRYKILPRVLINVAKVDTSTEILGTKVSLPFGFSPAASQKLAHPDGELATSRAA
FT                   ANFGICMGLSSYSNYSLEDVAAQGMGNPYVMQMCVLRDRSITLQLLQRAENAPNRPSLP
FT                   DPSLDWASTIPWLREHTSMQIWLKGVCSPADVELAIHYGVDGIVISNHGGRQLDGVPAT
FT                   LDSLRLCAEVAKGRIPLAIDGGIRRGSDIFKALALGARYCFMGRIPIWGLAYNGQEGVE
FT                   LAIKILRQELRVTMALAGCQTISEIRESHLSVLQPDGRLSKL"
     MAHRGESFHK DVSCIADLKA LGSSRLPATS DYYNEGAMDL ITLRDNEAAF DRYKILPRVL        60
     INVAKVDTST EILGTKVSLP FGFSPAASQK LAHPDGELAT SRAAANFGIC MGLSSYSNYS       120
     LEDVAAQGMG NPYVMQMCVL RDRSITLQLL QRAENAPNRP SLPDPSLDWA STIPWLREHT       180
     SMQIWLKGVC SPADVELAIH YGVDGIVISN HGGRQLDGVP ATLDSLRLCA EVAKGRIPLA       240
     IDGGIRRGSD IFKALALGAR YCFMGRIPIW GLAYNGQEGV ELAIKILRQE LRVTMALAGC       300
     QTISEIRESH LSVLQPDGRL SKL                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page