(data stored in ACNUC16935 zone)

EMBL: BN001307.PE5

BN001307.PE5         Location/Qualifiers
FT   CDS             join(13794..13962,14199..14275,14656..14821,14946..15722,
FT                   15829..15932,15994..16038,16078..16163,16193..16215,
FT                   16712..16806,17230..17271,17328..17333,17420..17437)
FT                   /locus_tag="ANIA_09056"
FT                   /old_locus_tag="AN9056.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007797"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007797"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007797"
FT                   /db_xref="GOA:Q5ARM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM4"
FT                   /protein_id="CBF84379.1"
FT                   /translation="MGLFSRDRGEPWDLGIRGLSLAVSGRTPTTIFSSGLTIYPSQCLP
FT                   QDSMLDCYRDRVAAAAMALQRSRMNPRAAIFLNDSHKAVSVQIQPSAAMSSPIPVGVFF
FT                   NIFALRRIRRRETTSSSTDLDSQEIPNVCYETCNGAFLEAAGRGKMAAICADGSTFSDL
FT                   VDQCRQCIELFVNSPSSNSTASASSGSTTAELNEFIAYCDEQGGGSGNSNVTLVKEIDS
FT                   LLASYSSLSSSQSQLQASLSSLGYTGDFPELTSATATGDVTASSTSMVGPTATAGGEDR
FT                   SFSNEGGTGTEDLPSSDTSDINIIAPAVIVPVFALLVGSVLAWALIRRRRKRQGTEEIG
FT                   AAGDSFDDKAQLHADEFRPELDGLAIAKKRLVNMDEDLAELPAREPIGAELDGLGRIPS
FT                   NLGMYNHDRLGALIQFFNITKKPKEFIGSWDNRIVNALNPSSMLTSQEQRDPSPGQLHR
FT                   IGASGNGELYSDSLAMRCSCTVVHKSVMNAQRGKGRRKLHLDLFNPTHETRQEMGWLDL
FT                   SFMQCRLSALRFKYSMIL"
     MGLFSRDRGE PWDLGIRGLS LAVSGRTPTT IFSSGLTIYP SQCLPQDSML DCYRDRVAAA        60
     AMALQRSRMN PRAAIFLNDS HKAVSVQIQP SAAMSSPIPV GVFFNIFALR RIRRRETTSS       120
     STDLDSQEIP NVCYETCNGA FLEAAGRGKM AAICADGSTF SDLVDQCRQC IELFVNSPSS       180
     NSTASASSGS TTAELNEFIA YCDEQGGGSG NSNVTLVKEI DSLLASYSSL SSSQSQLQAS       240
     LSSLGYTGDF PELTSATATG DVTASSTSMV GPTATAGGED RSFSNEGGTG TEDLPSSDTS       300
     DINIIAPAVI VPVFALLVGS VLAWALIRRR RKRQGTEEIG AAGDSFDDKA QLHADEFRPE       360
     LDGLAIAKKR LVNMDEDLAE LPAREPIGAE LDGLGRIPSN LGMYNHDRLG ALIQFFNITK       420
     KPKEFIGSWD NRIVNALNPS SMLTSQEQRD PSPGQLHRIG ASGNGELYSD SLAMRCSCTV       480
     VHKSVMNAQR GKGRRKLHLD LFNPTHETRQ EMGWLDLSFM QCRLSALRFK YSMIL            535
//

If you have problems or comments...

PBIL Back to PBIL home page