(data stored in ACNUC16935 zone)

EMBL: BN001307.PE51

BN001307.PE51        Location/Qualifiers
FT   CDS             complement(133560..134456)
FT                   /locus_tag="ANIA_09012"
FT                   /old_locus_tag="AN9012.4"
FT                   /product="dihydrodipicolinate synthetase family protein
FT                   (AFU_orthologue; AFUA_8G02270)"
FT                   /note="transcript_id=CADANIAT00007842"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007842"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007842"
FT                   /db_xref="GOA:Q5ARR8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR8"
FT                   /protein_id="CBF84463.1"
FT                   /translation="MSDLNLNGILVALVTPFTDDKTAIDEARLELHIKHMLDAGIHGLV
FT                   PGGSTGEFTTLSLSERKQLTELCVRFAGGRVPVVAGTGATSTSEAVELAVHAKEVGAAA
FT                   VMVVPPFYDPVNLQQLTELLAEIHEKSTLPIMYYNIPSASGLKLSPSEIAGLSRVGVRW
FT                   LKDTSGDAPAFTELVFGLSDQITALNGWDTLTFYGLAAGCPGGVWGAANIIPELAVELY
FT                   EAVSIKKDLDKGKELWSKAWPICKFLESHNYAAAVKTGVELTGQATGGLRKPFALLGPE
FT                   LQEELKGLLKNAGVATV"
     MSDLNLNGIL VALVTPFTDD KTAIDEARLE LHIKHMLDAG IHGLVPGGST GEFTTLSLSE        60
     RKQLTELCVR FAGGRVPVVA GTGATSTSEA VELAVHAKEV GAAAVMVVPP FYDPVNLQQL       120
     TELLAEIHEK STLPIMYYNI PSASGLKLSP SEIAGLSRVG VRWLKDTSGD APAFTELVFG       180
     LSDQITALNG WDTLTFYGLA AGCPGGVWGA ANIIPELAVE LYEAVSIKKD LDKGKELWSK       240
     AWPICKFLES HNYAAAVKTG VELTGQATGG LRKPFALLGP ELQEELKGLL KNAGVATV         298
//

If you have problems or comments...

PBIL Back to PBIL home page