(data stored in ACNUC16935 zone)

EMBL: BN001307.PE52

BN001307.PE52        Location/Qualifiers
FT   CDS             join(135753..136206,136268..137263,137345..137748)
FT                   /locus_tag="ANIA_09011"
FT                   /old_locus_tag="AN9011.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007843"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007843"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007843"
FT                   /db_xref="GOA:Q5ARR9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR9"
FT                   /protein_id="CBF84465.1"
FT                   /translation="MTQSQVHESGDSPVASIEEFTTTPFDFIVCGGGTAGLAIAARLSE
FT                   ISNVNVGIVEAGKYRIGDPLIETPATFMQMFEDPEYDWCLFTAPQEANNGKVHHIPRGK
FT                   VLGGSSAINYLMYVRGSLQDYDDWAALVGDEGWSAANMKAYMRKHQAQPVNPESKAAAS
FT                   PIAPEHHGTTGPIRTSFNESNLPIETDFVKACAETANLPNMPIDAWSGDHIGFYHTLGA
FT                   VARTGPNRGKRSYAGIEYYEANRLRPNLKLLCEARVNKVILNGTRATGVSITFRGQEYT
FT                   VSASREVIVSGGTIQSPQILELSGIGDPEVLAASGVQCLVENRAVGANVQDHSVSLISW
FT                   QMQPGVVTSDTLGQVPEAAAAALHQYAESRTGPLSSIGSTQGFIPVKSILSDAELAEIV
FT                   QSIRDIKPSSAFHEKQLQQVIAHLESETSANLQVVFLPCSVHENGVEHQRGLFTPPPVG
FT                   EPVCVSAAPCLQYPVSRGSIHINSNDPSVPPTIQPNYISHSADVALLAAFLSWIDRVGH
FT                   AAPFASSVSRRILPKSSLDLQDSEQAKRAIHDTVIGEYHICGSVAMGDALDSRLRVKGV
FT                   EGLRVVDASVFPNNVSGNIMSSVYAVAEKGADLVKEDHGLL"
     MTQSQVHESG DSPVASIEEF TTTPFDFIVC GGGTAGLAIA ARLSEISNVN VGIVEAGKYR        60
     IGDPLIETPA TFMQMFEDPE YDWCLFTAPQ EANNGKVHHI PRGKVLGGSS AINYLMYVRG       120
     SLQDYDDWAA LVGDEGWSAA NMKAYMRKHQ AQPVNPESKA AASPIAPEHH GTTGPIRTSF       180
     NESNLPIETD FVKACAETAN LPNMPIDAWS GDHIGFYHTL GAVARTGPNR GKRSYAGIEY       240
     YEANRLRPNL KLLCEARVNK VILNGTRATG VSITFRGQEY TVSASREVIV SGGTIQSPQI       300
     LELSGIGDPE VLAASGVQCL VENRAVGANV QDHSVSLISW QMQPGVVTSD TLGQVPEAAA       360
     AALHQYAESR TGPLSSIGST QGFIPVKSIL SDAELAEIVQ SIRDIKPSSA FHEKQLQQVI       420
     AHLESETSAN LQVVFLPCSV HENGVEHQRG LFTPPPVGEP VCVSAAPCLQ YPVSRGSIHI       480
     NSNDPSVPPT IQPNYISHSA DVALLAAFLS WIDRVGHAAP FASSVSRRIL PKSSLDLQDS       540
     EQAKRAIHDT VIGEYHICGS VAMGDALDSR LRVKGVEGLR VVDASVFPNN VSGNIMSSVY       600
     AVAEKGADLV KEDHGLL                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page