(data stored in ACNUC16935 zone)

EMBL: BN001307.PE54

BN001307.PE54        Location/Qualifiers
FT   CDS             join(140489..140562,140686..141154)
FT                   /locus_tag="ANIA_09009"
FT                   /old_locus_tag="AN9009.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007845"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007845"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007845"
FT                   /db_xref="GOA:Q5ARS1"
FT                   /db_xref="InterPro:IPR032345"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS1"
FT                   /protein_id="CBF84469.1"
FT                   /translation="MATVHPNAEKLISLAEEFFAEVADLTPGRALEEYLNEHYGPGNKY
FT                   YDTFCSLILSGLRNNEGWVATDELDGPRYRRSRLCDPSERTRYFSITTVYMQSQDEYRG
FT                   QYHLHPYGEINCVVQVDRTAELKGMNGWQAAGWTSPAAGTHHYPEVRGGALVALFFLPA
FT                   GRISYKATPEMAQPPYV"
     MATVHPNAEK LISLAEEFFA EVADLTPGRA LEEYLNEHYG PGNKYYDTFC SLILSGLRNN        60
     EGWVATDELD GPRYRRSRLC DPSERTRYFS ITTVYMQSQD EYRGQYHLHP YGEINCVVQV       120
     DRTAELKGMN GWQAAGWTSP AAGTHHYPEV RGGALVALFF LPAGRISYKA TPEMAQPPYV       180
//

If you have problems or comments...

PBIL Back to PBIL home page