(data stored in ACNUC16935 zone)

EMBL: BN001307.PE57

BN001307.PE57        Location/Qualifiers
FT   CDS             complement(join(151066..151248,151315..151647))
FT                   /locus_tag="ANIA_09006"
FT                   /old_locus_tag="AN9006.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007848"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007848"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007848"
FT                   /db_xref="GOA:Q5ARS4"
FT                   /db_xref="InterPro:IPR021054"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS4"
FT                   /protein_id="CBF84475.1"
FT                   /translation="MKVFNAILILYTLLPSLAIAQSPIDAALAQFQQLNDRIDSAQRSI
FT                   NAYNGGVLLALPVANSLYSAHTAATTARQSLTALDPLSPEDSQRALDAYNEVHPRLLAT
FT                   LAAGRDKAQVFRDAGVGYVAQGMISNLYNEKNRFEAALRDKIYPGYFQNDLAEAVDHAF
FT                   QGTLAQFY"
     MKVFNAILIL YTLLPSLAIA QSPIDAALAQ FQQLNDRIDS AQRSINAYNG GVLLALPVAN        60
     SLYSAHTAAT TARQSLTALD PLSPEDSQRA LDAYNEVHPR LLATLAAGRD KAQVFRDAGV       120
     GYVAQGMISN LYNEKNRFEA ALRDKIYPGY FQNDLAEAVD HAFQGTLAQF Y                171
//

If you have problems or comments...

PBIL Back to PBIL home page