(data stored in ACNUC16935 zone)

EMBL: BN001307.PE6

BN001307.PE6         Location/Qualifiers
FT   CDS             join(20646..20903,20993..21184)
FT                   /locus_tag="ANIA_09055"
FT                   /old_locus_tag="AN9055.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007798"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007798"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007798"
FT                   /db_xref="GOA:Q5ARM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM5"
FT                   /protein_id="CBF84381.1"
FT                   /translation="MQCCVKLVILISHADEIYENPTIFAEQRMYGRGSSVQHQTQTQTQ
FT                   TVAHELMFGKVVQLGVEYLFPGCGDKDPTLGKRDLFVRFQSSVYQPRKMVRYDVHESVR
FT                   IEDKTLETGVEYLIPSPTETGAGSCIGFLDGTELRSLLKAKNPIP"
     MQCCVKLVIL ISHADEIYEN PTIFAEQRMY GRGSSVQHQT QTQTQTVAHE LMFGKVVQLG        60
     VEYLFPGCGD KDPTLGKRDL FVRFQSSVYQ PRKMVRYDVH ESVRIEDKTL ETGVEYLIPS       120
     PTETGAGSCI GFLDGTELRS LLKAKNPIP                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page