(data stored in ACNUC16935 zone)

EMBL: BN001307.PE60

BN001307.PE60        Location/Qualifiers
FT   CDS             join(164400..168505,168547..168604)
FT                   /locus_tag="ANIA_09003"
FT                   /old_locus_tag="AN9003.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007851"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007851"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007851"
FT                   /db_xref="GOA:Q5ARS7"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS7"
FT                   /protein_id="CBF84480.1"
FT                   /translation="MDPLSITASVAGLATLAYQIIGYLGTVRSGGKDRLNLCREVTYLW
FT                   MSITSLLEQLSSDAIKDDKIPDSLRPLFDPDGIIKEIKIQLEDLEHTIKSRSTHGKIAQ
FT                   TLAWPFTQKDAEKMIDRIHRLKSTLQDGINQSTHALSQDIYRDGQGIKKVIDESRLKEL
FT                   IEWISPLNFITKQSMIWNEHHKGTCKWFLERDDFREWREGSNTRIFCPGIPGAGKTFLS
FT                   SIVYNELEALRVRDEGGLKGAAVVMLYCKWDDPLSQDIDNLLASVIKQFVQRYDVGTSD
FT                   MMELFTKHSKEGTRSSRAQLQSTLELLYSRFTKVFIILDGLDELRSEKEQLPLLMSLAP
FT                   NGSPYTVNLMVTSRPVPNIVRHFRHWPSLGGSIICDGCNAEGLAVQYHCADCEDYDLCQ
FT                   SCYKAGTRCGYKGHTYHLEFNARTIPIAAVEEDLTTYVHWRTSASETLQQFLEIKEGLM
FT                   DAILDTVVKNNEGMFLLAKFNMDTLESTLSIKQLMAALKTLPQELDGTYEDAMLRITEL
FT                   KASTRETVMRFLSWVVFAEQPLQEKAIEHALAVSDGDADIDDDNIIRARTLATKCAGLV
FT                   QLDESDCLRLVHYSAENYFRQHRDRWFPAGNVTIASSCLTYLQFDVFRSGACSGPSEDI
FT                   DFESRLSKYPFLRYASINWGKHLRVAADDHLSARALALITDAGCLATIAQALWYLEDQQ
FT                   QSNSWSSKNGSALHLATHFDLDILVKDLLSQGYDPNMRDINGVTPLALAVQRDLLDILI
FT                   TLTNAGASVNMPDNGGRSPLHWAIYHNLPDVVRFLLDHKDIDVNMPAARWSHYTPLMLA
FT                   SAYGFDDYVSMLLTKPKIDVNYASPEGATALILAARHGGTGAARLLLANQEIKINYADS
FT                   SGSTALTVAAENGYYDLVEALLDAGADTEVLQEGSNGTAIMRAIDDGRTSIVQLLVDRG
FT                   ANVHHKDVFDRGLLHSAAVNRRADILRILLKHDPTLDVNMQDVHGKTTLHDIARMGDLE
FT                   TVDVLLEAGGDPTIKDIHGRTPILVAHESHHPAILEMLRAARQRMKAEGQNYKLQRTPS
FT                   GTTVDSEDYGIKRADTGLSIHGTLPLWSLVVSKQFTELKERLPESSPEDINQVEPDMGQ
FT                   AALHWAVSDSDASIVKLLIDYGADINLRNRYGRTPLSLAVIDGLWDKARLLLEAGADPD
FT                   IEDQWGWPPLWMAGPRLGILLIENGAKLPPPPTFTGGGTDEGENIEKAAGKVDLENFLR
FT                   WAAQFGSETALRRLVQAGADVWSKDPSGKTPYMIAKEYGYDELANLLVQLAPMPQVGAD
FT                   GPRPKTDERAEKTATSGMPEDKSEDGTTKVKTDDIEKPKKEEDSVLPDKGMALDGLDST
FT                   TLVPASNVNKTKPGYSTLLLGSAHGRDGVGAIVMTIMHDGRRFD"
     MDPLSITASV AGLATLAYQI IGYLGTVRSG GKDRLNLCRE VTYLWMSITS LLEQLSSDAI        60
     KDDKIPDSLR PLFDPDGIIK EIKIQLEDLE HTIKSRSTHG KIAQTLAWPF TQKDAEKMID       120
     RIHRLKSTLQ DGINQSTHAL SQDIYRDGQG IKKVIDESRL KELIEWISPL NFITKQSMIW       180
     NEHHKGTCKW FLERDDFREW REGSNTRIFC PGIPGAGKTF LSSIVYNELE ALRVRDEGGL       240
     KGAAVVMLYC KWDDPLSQDI DNLLASVIKQ FVQRYDVGTS DMMELFTKHS KEGTRSSRAQ       300
     LQSTLELLYS RFTKVFIILD GLDELRSEKE QLPLLMSLAP NGSPYTVNLM VTSRPVPNIV       360
     RHFRHWPSLG GSIICDGCNA EGLAVQYHCA DCEDYDLCQS CYKAGTRCGY KGHTYHLEFN       420
     ARTIPIAAVE EDLTTYVHWR TSASETLQQF LEIKEGLMDA ILDTVVKNNE GMFLLAKFNM       480
     DTLESTLSIK QLMAALKTLP QELDGTYEDA MLRITELKAS TRETVMRFLS WVVFAEQPLQ       540
     EKAIEHALAV SDGDADIDDD NIIRARTLAT KCAGLVQLDE SDCLRLVHYS AENYFRQHRD       600
     RWFPAGNVTI ASSCLTYLQF DVFRSGACSG PSEDIDFESR LSKYPFLRYA SINWGKHLRV       660
     AADDHLSARA LALITDAGCL ATIAQALWYL EDQQQSNSWS SKNGSALHLA THFDLDILVK       720
     DLLSQGYDPN MRDINGVTPL ALAVQRDLLD ILITLTNAGA SVNMPDNGGR SPLHWAIYHN       780
     LPDVVRFLLD HKDIDVNMPA ARWSHYTPLM LASAYGFDDY VSMLLTKPKI DVNYASPEGA       840
     TALILAARHG GTGAARLLLA NQEIKINYAD SSGSTALTVA AENGYYDLVE ALLDAGADTE       900
     VLQEGSNGTA IMRAIDDGRT SIVQLLVDRG ANVHHKDVFD RGLLHSAAVN RRADILRILL       960
     KHDPTLDVNM QDVHGKTTLH DIARMGDLET VDVLLEAGGD PTIKDIHGRT PILVAHESHH      1020
     PAILEMLRAA RQRMKAEGQN YKLQRTPSGT TVDSEDYGIK RADTGLSIHG TLPLWSLVVS      1080
     KQFTELKERL PESSPEDINQ VEPDMGQAAL HWAVSDSDAS IVKLLIDYGA DINLRNRYGR      1140
     TPLSLAVIDG LWDKARLLLE AGADPDIEDQ WGWPPLWMAG PRLGILLIEN GAKLPPPPTF      1200
     TGGGTDEGEN IEKAAGKVDL ENFLRWAAQF GSETALRRLV QAGADVWSKD PSGKTPYMIA      1260
     KEYGYDELAN LLVQLAPMPQ VGADGPRPKT DERAEKTATS GMPEDKSEDG TTKVKTDDIE      1320
     KPKKEEDSVL PDKGMALDGL DSTTLVPASN VNKTKPGYST LLLGSAHGRD GVGAIVMTIM      1380
     HDGRRFD                                                                1387
//

If you have problems or comments...

PBIL Back to PBIL home page