(data stored in ACNUC16935 zone)

EMBL: BN001307.PE62

BN001307.PE62        Location/Qualifiers
FT   CDS             join(174071..174280,174339..174442,174502..175267)
FT                   /locus_tag="ANIA_09001"
FT                   /old_locus_tag="AN9001.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007853"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007853"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007853"
FT                   /db_xref="GOA:Q5ARS9"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS9"
FT                   /protein_id="CBF84484.1"
FT                   /translation="MQLLKVLPAPLFAALVASAPLAAPQISVDYGQLEQFAQDVQSFAD
FT                   STYSQFSQVSAQFDVLTGSYSGSGRESFGQLLAKLSASVYDIQRVSADIASTIDATASA
FT                   YEDAESSAIGTFFSKRDQLRARDNAAVMAEAGLMKEAGLMGEAGLMNEAGLMNKVDDSI
FT                   APVSGLQTAKDAVADMAEVDGVDDADAMSPVPTAAPSTGSVTPEQATGSGAENVTPEQA
FT                   TGSGAEGLNPQQATGSGAEGVTLEQATGSGAENVTPGQATGSGAEGVNPQQATGSGAEG
FT                   VTLEQATGSAGVDQTLGSDGTGIDENISADATGVDQTLGTADQHVPVVPEDPTAGVTFV
FT                   ANIKTAHEGTVETEDSHRP"
     MQLLKVLPAP LFAALVASAP LAAPQISVDY GQLEQFAQDV QSFADSTYSQ FSQVSAQFDV        60
     LTGSYSGSGR ESFGQLLAKL SASVYDIQRV SADIASTIDA TASAYEDAES SAIGTFFSKR       120
     DQLRARDNAA VMAEAGLMKE AGLMGEAGLM NEAGLMNKVD DSIAPVSGLQ TAKDAVADMA       180
     EVDGVDDADA MSPVPTAAPS TGSVTPEQAT GSGAENVTPE QATGSGAEGL NPQQATGSGA       240
     EGVTLEQATG SGAENVTPGQ ATGSGAEGVN PQQATGSGAE GVTLEQATGS AGVDQTLGSD       300
     GTGIDENISA DATGVDQTLG TADQHVPVVP EDPTAGVTFV ANIKTAHEGT VETEDSHRP        359
//

If you have problems or comments...

PBIL Back to PBIL home page