(data stored in ACNUC16935 zone)

EMBL: BN001307.PE64

BN001307.PE64        Location/Qualifiers
FT   CDS             join(179522..179564,179665..179771)
FT                   /locus_tag="ANIA_11639"
FT                   /old_locus_tag="AN11639.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007855"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007855"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007855"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL02"
FT                   /protein_id="CBF84488.1"
FT                   /translation="MPEYHPFDRVGSEKDPFTFILSTFSLPYHSRDLIALCKEDLTCKK
FT                   LELL"
     MPEYHPFDRV GSEKDPFTFI LSTFSLPYHS RDLIALCKED LTCKKLELL                    49
//

If you have problems or comments...

PBIL Back to PBIL home page