(data stored in ACNUC16935 zone)

EMBL: BN001307.PE65

BN001307.PE65        Location/Qualifiers
FT   CDS             join(180933..181923,181980..182188,182230..182504,
FT                   182557..182570,182615..182701,182778..183056,
FT                   183119..183199,183400..183466,183528..183600,
FT                   183901..184047)
FT                   /locus_tag="ANIA_08999"
FT                   /old_locus_tag="AN8999.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007856"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007856"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007856"
FT                   /db_xref="GOA:Q5ART1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART1"
FT                   /protein_id="CBF84489.1"
FT                   /translation="MAKQIQPKPSALATLIPELQWLIFNCLSFDDKVLFTEIGLFHPDL
FT                   LTSHGQTNTYDQHGRTLLHVAAEKGCVRAAQHLLCGGATPSAKMGPGARDFNTTPLILA
FT                   AQQENKELVNLLLSHGADVNDWDYSGITALHYAVIRGDGRIVRILLDKGAKQTNNYDIG
FT                   CPVHVAAASGALEILRLLVAHGADVGASKRGLSALDIALLNGNIAAARILVDAGAPLND
FT                   PVEGWGLFNPTLMVAGGPHAADAAEIVLDHSIASIDSVARQREVEEWWKPRQKGEYAEL
FT                   LQAMLVAGADPNQTFRSATPLHLAVVAGNEHAVRVLLEAGADVHARTDRALQRKEERER
FT                   VGGSTCCASQAGAFQCIWPLIFASISGVQSRSSISSVLRQPGNLCCFTPSLFARFKAHG
FT                   ENACLLFVERSDETRASAQSRGPGCQDSSTHLPAPIPIPMRRGAGSWRARRNVLRFRPM
FT                   YQGCCSKDYSSGFTPEHCDTGRISDCNATAEYGQLCAPTSSDTEVSPRIFAAMAVKRTP
FT                   TALDVASQSAMSFKRRIGYYELFNYYKGCNVIEPESLIIEPFTHINLAFVNLGDDYTLI
FT                   DEYGNIADCVLFLKFSNPGLRVNIAVGGWVFSDAPTQHLWTQMARSHEKQQTFINSVVK
FT                   YPQDYPRGCRASAQWQEVMNRLWQQSEKPLSPENFPGRMNRNDDMRLEARNREIKRTPF
FT                   TYYSRHNHPACQTRIHQWKKEKKVDEREEGDKTTNYPAAKSQSPKH"
     MAKQIQPKPS ALATLIPELQ WLIFNCLSFD DKVLFTEIGL FHPDLLTSHG QTNTYDQHGR        60
     TLLHVAAEKG CVRAAQHLLC GGATPSAKMG PGARDFNTTP LILAAQQENK ELVNLLLSHG       120
     ADVNDWDYSG ITALHYAVIR GDGRIVRILL DKGAKQTNNY DIGCPVHVAA ASGALEILRL       180
     LVAHGADVGA SKRGLSALDI ALLNGNIAAA RILVDAGAPL NDPVEGWGLF NPTLMVAGGP       240
     HAADAAEIVL DHSIASIDSV ARQREVEEWW KPRQKGEYAE LLQAMLVAGA DPNQTFRSAT       300
     PLHLAVVAGN EHAVRVLLEA GADVHARTDR ALQRKEERER VGGSTCCASQ AGAFQCIWPL       360
     IFASISGVQS RSSISSVLRQ PGNLCCFTPS LFARFKAHGE NACLLFVERS DETRASAQSR       420
     GPGCQDSSTH LPAPIPIPMR RGAGSWRARR NVLRFRPMYQ GCCSKDYSSG FTPEHCDTGR       480
     ISDCNATAEY GQLCAPTSSD TEVSPRIFAA MAVKRTPTAL DVASQSAMSF KRRIGYYELF       540
     NYYKGCNVIE PESLIIEPFT HINLAFVNLG DDYTLIDEYG NIADCVLFLK FSNPGLRVNI       600
     AVGGWVFSDA PTQHLWTQMA RSHEKQQTFI NSVVKYPQDY PRGCRASAQW QEVMNRLWQQ       660
     SEKPLSPENF PGRMNRNDDM RLEARNREIK RTPFTYYSRH NHPACQTRIH QWKKEKKVDE       720
     REEGDKTTNY PAAKSQSPKH                                                   740
//

If you have problems or comments...

PBIL Back to PBIL home page