(data stored in ACNUC16935 zone)

EMBL: BN001307.PE67

BN001307.PE67        Location/Qualifiers
FT   CDS             complement(join(188192..188338,188661..189040,
FT                   189465..189516))
FT                   /locus_tag="ANIA_08997"
FT                   /old_locus_tag="AN8997.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007858"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007858"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007858"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART3"
FT                   /protein_id="CBF84493.1"
FT                   /translation="MSTAEQAVWAHVAAVVLGSNAHETLMTKDLLGQTRWQEGRYTNAK
FT                   TLHQEAVDGLIRLKGIDNEDTLTATGNLGRTKAKFYENLDEAKSLLKRASHGMSKVLGT
FT                   THVKTLIVQEDLALLAAQMEEELCEPLETVQQVLDIRTKKLPGRLNESIQYCDEAIKGL
FT                   QKINATQHPLERELRAQKEEMVAMREQEG"
     MSTAEQAVWA HVAAVVLGSN AHETLMTKDL LGQTRWQEGR YTNAKTLHQE AVDGLIRLKG        60
     IDNEDTLTAT GNLGRTKAKF YENLDEAKSL LKRASHGMSK VLGTTHVKTL IVQEDLALLA       120
     AQMEEELCEP LETVQQVLDI RTKKLPGRLN ESIQYCDEAI KGLQKINATQ HPLERELRAQ       180
     KEEMVAMREQ EG                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page