(data stored in ACNUC16935 zone)

EMBL: BN001307.PE68

BN001307.PE68        Location/Qualifiers
FT   CDS             join(190605..190787,190832..190948,190998..191344,
FT                   191398..191951,192022..192377)
FT                   /locus_tag="ANIA_08996"
FT                   /old_locus_tag="AN8996.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007859"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007859"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007859"
FT                   /db_xref="GOA:Q5ART4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART4"
FT                   /protein_id="CBF84495.1"
FT                   /translation="MATVESKSPIDDVEKAPSEASDEERRREFLSSFTPEDDKRIMNKV
FT                   NRRFLWLIGVIYVIKTIDYTNAAAVKVLQVGEERNVLSELKMTTNEYNWVQSIYFISYI
FT                   VFEVPSNLLQKRLTPRLWQSRIMLTWGIVLACHAAVQNKHALYALRFLLGLCEAGMFPG
FT                   IAAQLCGWYRSDEMATPIMWMFGFQNTSGIIGSLITYGISYMNGLQDLSAWRWVYLLEG
FT                   LFTIAFSGVIFLVLPDWPKSERTKKWLTEREQEYVETRLSENAPKESDASFDKGEVIAA
FT                   LKDQRTYSFMISQILINFAGYALSWQLPTITTSLGFAGLPRNQLLNIPPAAASVLAIIF
FT                   SGWFLKRAYMTRPAYIMSVIIGPMLLFFILLAVLDNKVGIYIACVFGTMFYAVYFIPFW
FT                   AWRSSSLKGMTGSAFTLAFQSCVGQVGGVIGPQLFQSRFAYNGYKTPFAICAAVVGVAW
FT                   LTNGWTWWLTRNVEYDVMRVRRLRIKEEKQGRIYAGEDVQVYKERQFYDGMGRKKEQLE
FT                   V"
     MATVESKSPI DDVEKAPSEA SDEERRREFL SSFTPEDDKR IMNKVNRRFL WLIGVIYVIK        60
     TIDYTNAAAV KVLQVGEERN VLSELKMTTN EYNWVQSIYF ISYIVFEVPS NLLQKRLTPR       120
     LWQSRIMLTW GIVLACHAAV QNKHALYALR FLLGLCEAGM FPGIAAQLCG WYRSDEMATP       180
     IMWMFGFQNT SGIIGSLITY GISYMNGLQD LSAWRWVYLL EGLFTIAFSG VIFLVLPDWP       240
     KSERTKKWLT EREQEYVETR LSENAPKESD ASFDKGEVIA ALKDQRTYSF MISQILINFA       300
     GYALSWQLPT ITTSLGFAGL PRNQLLNIPP AAASVLAIIF SGWFLKRAYM TRPAYIMSVI       360
     IGPMLLFFIL LAVLDNKVGI YIACVFGTMF YAVYFIPFWA WRSSSLKGMT GSAFTLAFQS       420
     CVGQVGGVIG PQLFQSRFAY NGYKTPFAIC AAVVGVAWLT NGWTWWLTRN VEYDVMRVRR       480
     LRIKEEKQGR IYAGEDVQVY KERQFYDGMG RKKEQLEV                               518
//

If you have problems or comments...

PBIL Back to PBIL home page