(data stored in ACNUC16935 zone)

EMBL: BN001307.PE69

BN001307.PE69        Location/Qualifiers
FT   CDS             join(192843..193012,193068..193974)
FT                   /locus_tag="ANIA_08995"
FT                   /old_locus_tag="AN8995.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007860"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007860"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007860"
FT                   /db_xref="GOA:Q5ART5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART5"
FT                   /protein_id="CBF84497.1"
FT                   /translation="MASTSTENGPEKASATATIALNEPPAPAPAPSHPAKEGGLRGWLQ
FT                   VLSTLFILFNIWGLAFAFGSFQSFYVLDFLPSTSTSAISWTGTIQSWLLIMGGLVSGPL
FT                   FDLGYYVHLISIGSFLSVFGIMMLSLATKYYQILLSQGICAGLGFGLLYIPSLTIVSRT
FT                   FVRKRALALGIATAGAPAGGVIYTLMFEQLLPRAGFAWTVRIIGFVMLGLFIAAGVMVS
FT                   FTADTAKPSQARRPAVGKRQLFDTAALKDLPFWSYTLANFFLYLGYMSPFYYIPIYAET
FT                   KLHTSRSMGLYILIISQASSIIGRVVTTAVAHYFGAMVPWIITGIASGVLCMAWISATT
FT                   LARFILFAAFYGILLPEP"
     MASTSTENGP EKASATATIA LNEPPAPAPA PSHPAKEGGL RGWLQVLSTL FILFNIWGLA        60
     FAFGSFQSFY VLDFLPSTST SAISWTGTIQ SWLLIMGGLV SGPLFDLGYY VHLISIGSFL       120
     SVFGIMMLSL ATKYYQILLS QGICAGLGFG LLYIPSLTIV SRTFVRKRAL ALGIATAGAP       180
     AGGVIYTLMF EQLLPRAGFA WTVRIIGFVM LGLFIAAGVM VSFTADTAKP SQARRPAVGK       240
     RQLFDTAALK DLPFWSYTLA NFFLYLGYMS PFYYIPIYAE TKLHTSRSMG LYILIISQAS       300
     SIIGRVVTTA VAHYFGAMVP WIITGIASGV LCMAWISATT LARFILFAAF YGILLPEP         358
//

If you have problems or comments...

PBIL Back to PBIL home page