(data stored in ACNUC16935 zone)

EMBL: BN001307.PE7

BN001307.PE7         Location/Qualifiers
FT   CDS             join(24506..24670,24737..25444)
FT                   /locus_tag="ANIA_09054"
FT                   /old_locus_tag="AN9054.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007799"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007799"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007799"
FT                   /db_xref="GOA:Q5ARM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM6"
FT                   /protein_id="CBF84383.1"
FT                   /translation="MRSSIALVLAVGTAALADFTFDELWALQNTLWDNFLYPANLQQIN
FT                   ATDTSVFAENVQGRVDITRTFDGRELNNEYIFGLFSDPSHLSLVGIPISYNITQFAANQ
FT                   NITSATTVFTFNATSFNILVPITIDTWILYNADGKILQYDATFRWFGWLLDTLLEAAGT
FT                   GIFNTTDPAETQRALGNLLATTICQTHGQHCVDDNQQYNSNEDCVRFLTEDIRFGSAYE
FT                   LGRNTLLCREVHEHMVQYRPTEHCPHIGPDGGGYCVDDKDYAEVVTERYFREPFVPYGY
FT                   GDTNLWVAA"
     MRSSIALVLA VGTAALADFT FDELWALQNT LWDNFLYPAN LQQINATDTS VFAENVQGRV        60
     DITRTFDGRE LNNEYIFGLF SDPSHLSLVG IPISYNITQF AANQNITSAT TVFTFNATSF       120
     NILVPITIDT WILYNADGKI LQYDATFRWF GWLLDTLLEA AGTGIFNTTD PAETQRALGN       180
     LLATTICQTH GQHCVDDNQQ YNSNEDCVRF LTEDIRFGSA YELGRNTLLC REVHEHMVQY       240
     RPTEHCPHIG PDGGGYCVDD KDYAEVVTER YFREPFVPYG YGDTNLWVAA                  290
//

If you have problems or comments...

PBIL Back to PBIL home page