(data stored in ACNUC16935 zone)

EMBL: BN001307.PE70

BN001307.PE70        Location/Qualifiers
FT   CDS             complement(join(194447..194817,194886..195387))
FT                   /locus_tag="ANIA_08994"
FT                   /old_locus_tag="AN8994.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007861"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007861"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007861"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART6"
FT                   /protein_id="CBF84499.1"
FT                   /translation="MHYDQPPAYTETTLTAASLVGPALDRPSSSHSSTASIPSVSISLS
FT                   NTTATETSPKGGDASSSFAMLSLGDSDKLRFIRFPDHLIVIASEVITRLWPKGIQKTQN
FT                   FDESVQFKLKGNPLGYSFDGEKAAIRVTIMGLLNAFAKEGWVVLPAGKVGKMGRGDSQS
FT                   YGQGDSLVFHRQHPESRSWLCVSFDSADLLHLLNAPAELTTLLLASFGDRIEKCNKDFV
FT                   SGNFELKFKGSPWTKTGAKGAVQCRLILLDLMQCFEEHGYTMCTALDIDGGLGGTEYKS
FT                   NGEAWFWYR"
     MHYDQPPAYT ETTLTAASLV GPALDRPSSS HSSTASIPSV SISLSNTTAT ETSPKGGDAS        60
     SSFAMLSLGD SDKLRFIRFP DHLIVIASEV ITRLWPKGIQ KTQNFDESVQ FKLKGNPLGY       120
     SFDGEKAAIR VTIMGLLNAF AKEGWVVLPA GKVGKMGRGD SQSYGQGDSL VFHRQHPESR       180
     SWLCVSFDSA DLLHLLNAPA ELTTLLLASF GDRIEKCNKD FVSGNFELKF KGSPWTKTGA       240
     KGAVQCRLIL LDLMQCFEEH GYTMCTALDI DGGLGGTEYK SNGEAWFWYR                  290
//

If you have problems or comments...

PBIL Back to PBIL home page