(data stored in ACNUC16935 zone)

EMBL: BN001307.PE71

BN001307.PE71        Location/Qualifiers
FT   CDS             join(196975..198404,198774..198781,199152..199217,
FT                   199300..199327,199393..200572)
FT                   /locus_tag="ANIA_08993"
FT                   /old_locus_tag="AN8993.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007862"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007862"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007862"
FT                   /db_xref="GOA:Q5ART7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART7"
FT                   /protein_id="CBF84500.1"
FT                   /translation="MMQIDLADDQDERQRRLQEWDSDDDPGNPRNWSTLRKTLTTTVIG
FT                   LIGFATTVNASIYSSGHEQVKRDFNVSTTVSLLPLSAYSLGLAFGPMISSPLSETFGRK
FT                   FVYLLTLPMVDLFTLGVGASQGIASLIVCRFVAGVFAAPGVSVAAATITDYTPPSRRVI
FT                   PLGIYYAIPTIGSSMGPLIGSFVVEQRGWRWTAWTPLIMAAVVHPPAIFIRESYKPILL
FT                   QRRAEKLGGEGVLPVQRQTAMQLFKEFVTSTIVRPLHMLFTEPLVGFICLYCGFQFALL
FT                   YTFIVASPRVFADVYGFSPSGQGLSFLGMVAGCICAPLVLFTVDRIVQLNPTLRIRNNN
FT                   TEGGGSPPELKLYTAMFGSLILPTGLFLFAWTAKPHIHWMAPIVAQSLTFLGSMLIYIP
FT                   CNFYMLDVYGSKYGASASGASSLTRYTLSTAFPLFVPQMYDALGVDWATSLLGFLATVM
FT                   APIPWVFFYKGPGFRARSGINIYIIPRSLKLAKENVAKGQPFGPVHWGRISGLFAGHLR
FT                   TQGIRTSPGPSSARFGSVHSNHSYSYILSPICLPINKATLSEMTAPHRRKPIPQPHGRS
FT                   HSHPTAISHPHPHSPAPAYTRPAQPRAPQQMAYHPPQSLAHGTPAPARSRSHYLPHPRS
FT                   APAQARQLSHIQTTQRHHGQQLKQHTTQISQHANTMKSQAKLNQSAQKENAQIAKSMQK
FT                   QFAAQQKTFNKHANAQQRAFDKQSAAHQKHFEKQNAALAAQYERDRAAMDHEMEQIRHA
FT                   DAQRQYEYEQYMWYKSQAQVEQDRKDWDKTVAGVVAGAALGAAAGAAAGVAWEREQWEE
FT                   QRLQAEAERQEDSSELEPSDYEYESRNEGYQTQSLGYDNGNSGYNDSGYEQQQPYTSLD
FT                   FMTQNRDGNDGDDDCCDGCCGGNGNDDDDCCC"
     MMQIDLADDQ DERQRRLQEW DSDDDPGNPR NWSTLRKTLT TTVIGLIGFA TTVNASIYSS        60
     GHEQVKRDFN VSTTVSLLPL SAYSLGLAFG PMISSPLSET FGRKFVYLLT LPMVDLFTLG       120
     VGASQGIASL IVCRFVAGVF AAPGVSVAAA TITDYTPPSR RVIPLGIYYA IPTIGSSMGP       180
     LIGSFVVEQR GWRWTAWTPL IMAAVVHPPA IFIRESYKPI LLQRRAEKLG GEGVLPVQRQ       240
     TAMQLFKEFV TSTIVRPLHM LFTEPLVGFI CLYCGFQFAL LYTFIVASPR VFADVYGFSP       300
     SGQGLSFLGM VAGCICAPLV LFTVDRIVQL NPTLRIRNNN TEGGGSPPEL KLYTAMFGSL       360
     ILPTGLFLFA WTAKPHIHWM APIVAQSLTF LGSMLIYIPC NFYMLDVYGS KYGASASGAS       420
     SLTRYTLSTA FPLFVPQMYD ALGVDWATSL LGFLATVMAP IPWVFFYKGP GFRARSGINI       480
     YIIPRSLKLA KENVAKGQPF GPVHWGRISG LFAGHLRTQG IRTSPGPSSA RFGSVHSNHS       540
     YSYILSPICL PINKATLSEM TAPHRRKPIP QPHGRSHSHP TAISHPHPHS PAPAYTRPAQ       600
     PRAPQQMAYH PPQSLAHGTP APARSRSHYL PHPRSAPAQA RQLSHIQTTQ RHHGQQLKQH       660
     TTQISQHANT MKSQAKLNQS AQKENAQIAK SMQKQFAAQQ KTFNKHANAQ QRAFDKQSAA       720
     HQKHFEKQNA ALAAQYERDR AAMDHEMEQI RHADAQRQYE YEQYMWYKSQ AQVEQDRKDW       780
     DKTVAGVVAG AALGAAAGAA AGVAWEREQW EEQRLQAEAE RQEDSSELEP SDYEYESRNE       840
     GYQTQSLGYD NGNSGYNDSG YEQQQPYTSL DFMTQNRDGN DGDDDCCDGC CGGNGNDDDD       900
     CCC                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page