(data stored in ACNUC16935 zone)

EMBL: BN001307.PE72

BN001307.PE72        Location/Qualifiers
FT   CDS             join(201294..202154,202268..202388,202433..202452)
FT                   /locus_tag="ANIA_08992"
FT                   /old_locus_tag="AN8992.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007863"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007863"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007863"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART8"
FT                   /protein_id="CBF84502.1"
FT                   /translation="MSYPTVRPSRLTVFSRDGTLIIIVPLNHEAGAGEQGGPGQGSLPA
FT                   QPPAAGFRTSADQLKRVSPLMNRVLTTLEAQTMLRSPRGLDYVLPKYDPDLVRLFLTIL
FT                   HNPQHPITPLTDLLQIAKLTQIAAFFECPSLIASHVSAWLSSRDSEPPRTYCPTLMVFV
FT                   SISLHLHFDNMFAKYTSIAIAESPGQITSMGAPISGDVLEDLNQRRNCFIGAHFDVLHN
FT                   TLNVLLKGPPGCTVDCDSRMLDALMNQMKQHGLLRPKPAAPYSGLTHRQLASTIASFKC
FT                   PAGVDMKTVLTLPPSLQNAAFIWSLRVQQADYVPFCSWTCSLQRIAGQLEWV"
     MSYPTVRPSR LTVFSRDGTL IIIVPLNHEA GAGEQGGPGQ GSLPAQPPAA GFRTSADQLK        60
     RVSPLMNRVL TTLEAQTMLR SPRGLDYVLP KYDPDLVRLF LTILHNPQHP ITPLTDLLQI       120
     AKLTQIAAFF ECPSLIASHV SAWLSSRDSE PPRTYCPTLM VFVSISLHLH FDNMFAKYTS       180
     IAIAESPGQI TSMGAPISGD VLEDLNQRRN CFIGAHFDVL HNTLNVLLKG PPGCTVDCDS       240
     RMLDALMNQM KQHGLLRPKP AAPYSGLTHR QLASTIASFK CPAGVDMKTV LTLPPSLQNA       300
     AFIWSLRVQQ ADYVPFCSWT CSLQRIAGQL EWV                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page