(data stored in ACNUC16935 zone)

EMBL: BN001307.PE73

BN001307.PE73        Location/Qualifiers
FT   CDS             join(203563..203773,203858..203914,204148..204169,
FT                   204294..204378)
FT                   /locus_tag="ANIA_08991"
FT                   /old_locus_tag="AN8991.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007864"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007864"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007864"
FT                   /db_xref="GOA:Q5ART9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART9"
FT                   /protein_id="CBF84504.1"
FT                   /translation="MHMPPSQKEQPGWHRAPRLLNQGFQYLWEQRVDSSPGSNGVWSLT
FT                   LDKWTFSVYEYSSDAEQFCAKGDCAGRTGGSSARIAWGTRFWSADKGLEEGSGGAVRLE
FT                   ARTDVIVAEQNSLTWYRDWR"
     MHMPPSQKEQ PGWHRAPRLL NQGFQYLWEQ RVDSSPGSNG VWSLTLDKWT FSVYEYSSDA        60
     EQFCAKGDCA GRTGGSSARI AWGTRFWSAD KGLEEGSGGA VRLEARTDVI VAEQNSLTWY       120
     RDWR                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page