(data stored in ACNUC16935 zone)

EMBL: BN001307.PE75

BN001307.PE75        Location/Qualifiers
FT   CDS             complement(join(208084..208110,208214..208356,
FT                   208448..208649))
FT                   /locus_tag="ANIA_08989"
FT                   /old_locus_tag="AN8989.4"
FT                   /product="glyoxalase family protein (AFU_orthologue;
FT                   AFUA_5G14830)"
FT                   /note="transcript_id=CADANIAT00007866"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007866"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007866"
FT                   /db_xref="GOA:Q5ARU1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU1"
FT                   /protein_id="CBF84508.1"
FT                   /translation="MELDPTAPLPSSKIDHIGITAPTEQLESLIEFYLKALALAPLQRD
FT                   HAVSWGCWARRQGPGFLDLRDEDRKTVDAFHEAALAAGGKCNGKPGLRTEYHPNYYAAF
FT                   IIDPRGNNVEIVCHLPVEE"
     MELDPTAPLP SSKIDHIGIT APTEQLESLI EFYLKALALA PLQRDHAVSW GCWARRQGPG        60
     FLDLRDEDRK TVDAFHEAAL AAGGKCNGKP GLRTEYHPNY YAAFIIDPRG NNVEIVCHLP       120
     VEE                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page