(data stored in ACNUC16935 zone)

EMBL: BN001307.PE76

BN001307.PE76        Location/Qualifiers
FT   CDS             complement(join(209040..209128,209210..210022,
FT                   210076..210298))
FT                   /locus_tag="ANIA_08988"
FT                   /old_locus_tag="AN8988.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007867"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007867"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU2"
FT                   /protein_id="CBF84510.1"
FT                   /translation="MPKLFITGITGYIGGDAFHLLSQKHRDFEFSALVRTEAKAKYVRE
FT                   LYPNVRIVIGGLDDADKIEKEAAWADIVLHTADSSDHVGAANAIARGLVQGHSLDRPGY
FT                   WLHTGGTGILTYFDSDVHKVHGEHNDKVFNDYEGVSELTNLPAAAFHRNVDEIVLRTGV
FT                   EHADRVKTVIVCPPTIYGRGRGPVALRGRQAYELTSFVLKEKYVPIIGKGLARWNNVHI
FT                   YDLSRLFDLLVRAALDPARKDDKEIWGEKGYFLCENGEHVWGELSKLVGEQAHKLGYLK
FT                   DAPVVKEMSVDEAISSPAGFEAASWGWNSRGQAQRGREVLGWSPEEKSIEEEIPDILAA
FT                   EASRLDGQFSLTIMFPPTGETRLLIAVESSFADE"
     MPKLFITGIT GYIGGDAFHL LSQKHRDFEF SALVRTEAKA KYVRELYPNV RIVIGGLDDA        60
     DKIEKEAAWA DIVLHTADSS DHVGAANAIA RGLVQGHSLD RPGYWLHTGG TGILTYFDSD       120
     VHKVHGEHND KVFNDYEGVS ELTNLPAAAF HRNVDEIVLR TGVEHADRVK TVIVCPPTIY       180
     GRGRGPVALR GRQAYELTSF VLKEKYVPII GKGLARWNNV HIYDLSRLFD LLVRAALDPA       240
     RKDDKEIWGE KGYFLCENGE HVWGELSKLV GEQAHKLGYL KDAPVVKEMS VDEAISSPAG       300
     FEAASWGWNS RGQAQRGREV LGWSPEEKSI EEEIPDILAA EASRLDGQFS LTIMFPPTGE       360
     TRLLIAVESS FADE                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page