(data stored in ACNUC16935 zone)

EMBL: BN001307.PE77

BN001307.PE77        Location/Qualifiers
FT   CDS             complement(join(210491..210617,210693..210780,
FT                   210882..211314,211855..212244))
FT                   /locus_tag="ANIA_08987"
FT                   /old_locus_tag="AN8987.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007868"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007868"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007868"
FT                   /db_xref="GOA:Q5ARU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU3"
FT                   /protein_id="CBF84512.1"
FT                   /translation="MVLAQRLLGVLLVDIGLLQLVVVVSRNRAGVYLTQYTPRVRRKLN
FT                   RNSTEMCINLRGYSRLSMGVVELTIRLRGSWRLSMWAGQHRDVDGHSLSPLTDVAVNQR
FT                   AIFQNGLRKQRSMRYCSLVLLLEGQAVIDIRSQWGGLAVKIGPEWARLQNCRPGENPVT
FT                   LSGEDHRIVMGWRYRAASGLIRRPSPAWLDSSPVSNSQQQSPGKPQQDHALMAEMMMKK
FT                   KQRVVIAKLSTRSLREEETCAAGGSRSPAPFPPVILWSATFSSLTAALCLNWPSRLAWT
FT                   SHQPQGQISGDNPEHQNDKTFEHVDDTPVDHHEERKSGSNERYVHLFLHVNTMLLPWIT
FT                   VAHQP"
     MVLAQRLLGV LLVDIGLLQL VVVVSRNRAG VYLTQYTPRV RRKLNRNSTE MCINLRGYSR        60
     LSMGVVELTI RLRGSWRLSM WAGQHRDVDG HSLSPLTDVA VNQRAIFQNG LRKQRSMRYC       120
     SLVLLLEGQA VIDIRSQWGG LAVKIGPEWA RLQNCRPGEN PVTLSGEDHR IVMGWRYRAA       180
     SGLIRRPSPA WLDSSPVSNS QQQSPGKPQQ DHALMAEMMM KKKQRVVIAK LSTRSLREEE       240
     TCAAGGSRSP APFPPVILWS ATFSSLTAAL CLNWPSRLAW TSHQPQGQIS GDNPEHQNDK       300
     TFEHVDDTPV DHHEERKSGS NERYVHLFLH VNTMLLPWIT VAHQP                       345
//

If you have problems or comments...

PBIL Back to PBIL home page