(data stored in ACNUC16935 zone)

EMBL: BN001307.PE78

BN001307.PE78        Location/Qualifiers
FT   CDS             join(215468..215878,215937..216779)
FT                   /locus_tag="ANIA_08986"
FT                   /old_locus_tag="AN8986.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007869"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007869"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007869"
FT                   /db_xref="GOA:Q5ARU4"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU4"
FT                   /protein_id="CBF84514.1"
FT                   /translation="MRRASRQSFLPLLARRRLSFLLILLFLLFLLHALPPVFSQRRNRR
FT                   VVGGKWLPDYDVNELPRYLHRSPYREKPDIEFEQRVREALKGIEEDALAAAGIGDDRLA
FT                   EQRIWQIRLGGGNDEHVEDSLAFTKRNSEWEYTLMTDHQANEFIATVLASIPDLKALYD
FT                   SYPYHVMRSDLLRYLVLWYYGGYYADMDVYPAKAIKECPALQPVFGDSGSANISLAVGI
FT                   EIDEPHASLQLMRDWHWIRTYGLIQYTFFAPRRFSPLLREVIIRVLSHTRQRNQQSFPF
FT                   VGPRYDEKAILEVTGPGVFTDAILDALSDALPTTHPLLAASVRADEGIGDLFSQASGQL
FT                   SRRVTWAPFHRISEPLCVDAQEAAVGKSMGGICVLPVNAWGNGQRHSGAGGFSSPLACV
FT                   NHRFGGSWKKDWWYRHFG"
     MRRASRQSFL PLLARRRLSF LLILLFLLFL LHALPPVFSQ RRNRRVVGGK WLPDYDVNEL        60
     PRYLHRSPYR EKPDIEFEQR VREALKGIEE DALAAAGIGD DRLAEQRIWQ IRLGGGNDEH       120
     VEDSLAFTKR NSEWEYTLMT DHQANEFIAT VLASIPDLKA LYDSYPYHVM RSDLLRYLVL       180
     WYYGGYYADM DVYPAKAIKE CPALQPVFGD SGSANISLAV GIEIDEPHAS LQLMRDWHWI       240
     RTYGLIQYTF FAPRRFSPLL REVIIRVLSH TRQRNQQSFP FVGPRYDEKA ILEVTGPGVF       300
     TDAILDALSD ALPTTHPLLA ASVRADEGIG DLFSQASGQL SRRVTWAPFH RISEPLCVDA       360
     QEAAVGKSMG GICVLPVNAW GNGQRHSGAG GFSSPLACVN HRFGGSWKKD WWYRHFG          417
//

If you have problems or comments...

PBIL Back to PBIL home page