(data stored in ACNUC16935 zone)

EMBL: BN001307.PE79

BN001307.PE79        Location/Qualifiers
FT   CDS             join(217281..218362,218406..218464,218511..218962)
FT                   /locus_tag="ANIA_08985"
FT                   /old_locus_tag="AN8985.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007870"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007870"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007870"
FT                   /db_xref="GOA:Q5ARU5"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU5"
FT                   /protein_id="CBF84515.1"
FT                   /translation="MAEYTSDADVELAYTTLQTTFKSGKTKEIAWRKWQLKQIWWLVDD
FT                   NEALIQEALKKDMNRHPFETTFTECANVKGDVIEHLKNIDKWTADQKPSAGMLGLMLRP
FT                   TVRPEPLGVALIIGPWNFPFSLLVQPLIAAITAGCAALLKPSEVTSSVQQLFVDLVPKY
FT                   LDTSAVRVVTGGPAETGCLLQRKFDHIFFTGSVPVARHIAAAAAKHLTPTVLELGGQCP
FT                   AIVTSSADVDAAAKDIAWIKYLNAGQICLSVNHVFAHPSVERKLIERMAFWLDRFYKGE
FT                   KDAMTHIVNDKNYARIKQLAEKTKGKIELDGTADAETRSLPVSIVSNVEMSDPLLSEEL
FT                   FGTVCPVIKGSTDDAIKSINSLPRPLALYIFSQDQNEVEHIISSTLSGGVCVNGVLVHA
FT                   MVPNAPFGGVGDSGHGAYHGEYGFKSFTHYRTIARPAPFFFKMSEWMRPPYSVDNIKKL
FT                   AVRNSVGIQRNWSLEQEREAIKRGLLLTKSLKSARFLVYLVVLLGLADVGLDRRLGVLK
FT                   SVRDLLVEVRSLF"
     MAEYTSDADV ELAYTTLQTT FKSGKTKEIA WRKWQLKQIW WLVDDNEALI QEALKKDMNR        60
     HPFETTFTEC ANVKGDVIEH LKNIDKWTAD QKPSAGMLGL MLRPTVRPEP LGVALIIGPW       120
     NFPFSLLVQP LIAAITAGCA ALLKPSEVTS SVQQLFVDLV PKYLDTSAVR VVTGGPAETG       180
     CLLQRKFDHI FFTGSVPVAR HIAAAAAKHL TPTVLELGGQ CPAIVTSSAD VDAAAKDIAW       240
     IKYLNAGQIC LSVNHVFAHP SVERKLIERM AFWLDRFYKG EKDAMTHIVN DKNYARIKQL       300
     AEKTKGKIEL DGTADAETRS LPVSIVSNVE MSDPLLSEEL FGTVCPVIKG STDDAIKSIN       360
     SLPRPLALYI FSQDQNEVEH IISSTLSGGV CVNGVLVHAM VPNAPFGGVG DSGHGAYHGE       420
     YGFKSFTHYR TIARPAPFFF KMSEWMRPPY SVDNIKKLAV RNSVGIQRNW SLEQEREAIK       480
     RGLLLTKSLK SARFLVYLVV LLGLADVGLD RRLGVLKSVR DLLVEVRSLF                  530
//

If you have problems or comments...

PBIL Back to PBIL home page