(data stored in ACNUC16935 zone)

EMBL: BN001307.PE8

BN001307.PE8         Location/Qualifiers
FT   CDS             join(29725..29979,30073..30510)
FT                   /locus_tag="ANIA_09053"
FT                   /old_locus_tag="AN9053.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007800"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007800"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007800"
FT                   /db_xref="GOA:Q5ARM7"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM7"
FT                   /protein_id="CBF84384.1"
FT                   /translation="MAEAIKRAEIYGIGMVSVNHSNHFGMAATYVLQALQANMISLVFT
FT                   SSAKQMPPFGGKETPLGIAPFAAGAPSNREVPYILDIAPSTPMSPQRKYGSDRRTKGLG
FT                   SGIAILMDIMSSVLTVAGFGGQVGDRYKDAKPQDAGHCFIAIKPDVCFSVDDLKARMDT
FT                   LVQRVHGVIPAPGFSEVLFPGEPEQRLCLQRRREGIPYADAERKMFTESAKQYGVPELL
FT                   LSETPLSV"
     MAEAIKRAEI YGIGMVSVNH SNHFGMAATY VLQALQANMI SLVFTSSAKQ MPPFGGKETP        60
     LGIAPFAAGA PSNREVPYIL DIAPSTPMSP QRKYGSDRRT KGLGSGIAIL MDIMSSVLTV       120
     AGFGGQVGDR YKDAKPQDAG HCFIAIKPDV CFSVDDLKAR MDTLVQRVHG VIPAPGFSEV       180
     LFPGEPEQRL CLQRRREGIP YADAERKMFT ESAKQYGVPE LLLSETPLSV                  230
//

If you have problems or comments...

PBIL Back to PBIL home page