(data stored in ACNUC16935 zone)

EMBL: BN001307.PE80

BN001307.PE80        Location/Qualifiers
FT   CDS             join(220614..220760,220810..221191,221287..221404,
FT                   221590..221620,221693..221703,221733..222093)
FT                   /locus_tag="ANIA_08984"
FT                   /old_locus_tag="AN8984.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007871"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007871"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007871"
FT                   /db_xref="GOA:Q5ARU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU6"
FT                   /protein_id="CBF84517.1"
FT                   /translation="MAGDERVSITAVSWTLGTLSILLVALRLYTRLLITRCRGWDDLFV
FT                   TIALVNAIICSALTQIAVSHGLGKHEADIPNPNDRISAAKYATIAPSFSVISTVTGKIS
FT                   VVIFLLRLLTLSAKPWHRWFLHSLTLASIAWNILGIVAIIGYCRPTRKIWLPETEGSCM
FT                   SSRFQLVAGISQSAFNAFADWALALFPAILFRKVQLPLLKKVVVIAVLGSGVLDMARHH
FT                   EMVYVELRQQPKIWNEQMYLIIICASVPTMPQSLNALLHLCKTYHKYNSSSSRCNLSRP
FT                   SIREPGVLLKRMQDSSLFDAPAEHAGSQENILACNEGELNTNIGCMIDLTVAQDSDIGD
FT                   IVLVQGGTN"
     MAGDERVSIT AVSWTLGTLS ILLVALRLYT RLLITRCRGW DDLFVTIALV NAIICSALTQ        60
     IAVSHGLGKH EADIPNPNDR ISAAKYATIA PSFSVISTVT GKISVVIFLL RLLTLSAKPW       120
     HRWFLHSLTL ASIAWNILGI VAIIGYCRPT RKIWLPETEG SCMSSRFQLV AGISQSAFNA       180
     FADWALALFP AILFRKVQLP LLKKVVVIAV LGSGVLDMAR HHEMVYVELR QQPKIWNEQM       240
     YLIIICASVP TMPQSLNALL HLCKTYHKYN SSSSRCNLSR PSIREPGVLL KRMQDSSLFD       300
     APAEHAGSQE NILACNEGEL NTNIGCMIDL TVAQDSDIGD IVLVQGGTN                   349
//

If you have problems or comments...

PBIL Back to PBIL home page