(data stored in ACNUC16935 zone)

EMBL: BN001307.PE84

BN001307.PE84        Location/Qualifiers
FT   CDS             229515..230204
FT                   /locus_tag="ANIA_08980"
FT                   /old_locus_tag="AN8980.4"
FT                   /product="AlcMPredicted protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARV0]"
FT                   /note="transcript_id=CADANIAT00007875"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007875"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007875"
FT                   /db_xref="GOA:Q5ARV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV0"
FT                   /protein_id="CBF84524.1"
FT                   /translation="MDDPLLRAWTTQYTNSPITTPRSATPGECRLRPPRDERVEKPRHP
FT                   KNPPTPPSMSMPYAVSSVPQGNMCNVDRGNGALEYINPSLLLFPQDYASQESNNYASAR
FT                   RVSDRRIGQSPYTRPNTPNVEGVSNVSSSDQRSSLSGRNGREEQSNPPVDIFEGILAKM
FT                   LAFDVVRPPSTNELGNDEPPREVEAKQPTVHHGFAISVGWSSTFFPDDIQEGSGHSRNT
FT                   VDTVGHF"
     MDDPLLRAWT TQYTNSPITT PRSATPGECR LRPPRDERVE KPRHPKNPPT PPSMSMPYAV        60
     SSVPQGNMCN VDRGNGALEY INPSLLLFPQ DYASQESNNY ASARRVSDRR IGQSPYTRPN       120
     TPNVEGVSNV SSSDQRSSLS GRNGREEQSN PPVDIFEGIL AKMLAFDVVR PPSTNELGND       180
     EPPREVEAKQ PTVHHGFAIS VGWSSTFFPD DIQEGSGHSR NTVDTVGHF                   229
//

If you have problems or comments...

PBIL Back to PBIL home page