(data stored in ACNUC16935 zone)

EMBL: BN001307.PE86

BN001307.PE86        Location/Qualifiers
FT   CDS             join(234657..234731,234792..237182)
FT                   /locus_tag="ANIA_08978"
FT                   /old_locus_tag="AN8978.4"
FT                   /product="Regulatory protein alcR
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P21228]"
FT                   /note="transcript_id=CADANIAT00007877"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007877"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007877"
FT                   /db_xref="GOA:P21228"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PDB:1F4S"
FT                   /db_xref="PDB:1F5E"
FT                   /db_xref="PDB:2ALC"
FT                   /db_xref="PDB:3ALC"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21228"
FT                   /protein_id="CBF84528.1"
FT                   /translation="MADTRRRQNHSCDPCRKGKRRCDAPENRNEANENGWVSCSNCKRW
FT                   NKDCTFNWLSSQRSKAKGAAPRARTKKARTATTTSEPSTSAATIPTPESDNHDAPPVIN
FT                   SHDALPSWTQGLLSHPGDLFDFSHSAIPANAEDAANVQSDAPFPWDLAIPGDFSMGQQL
FT                   EKPLSPLSFQAVLLPPHSPNTDDLIRELEEQTTDPDSVTDTNSVQQVAQDGSLWSDRQS
FT                   PLLPENSLCMASDSTARRYARSTMTKNLMRIYHDSMENALSCWLTEHNCPYSDQISYLP
FT                   PKQRAEWGPNWSNRMCIRVCRLDRVSTSLRGRALSAEEDKAAARALHLAIVAFASQWTQ
FT                   HAQRGAGLNVPADIAADERSIRRNAWNEARHALQHTTGIPSFRVIFANIIFSLTQSVLD
FT                   DDEQHGMGARLDKLLENDGAPVFLETANRQLYTFRHKFARMQRRGKAFNRLPGGSVAST
FT                   FAGIFETPTPSSESPQLDPVVASEEHRSTLSLMFWLGIMFDTLSAAMYQRPLVVSDEDS
FT                   QISSASPPRRGAETPINLDCWEPPRQVPSNQEKSDVWGDLFLRTSDSLPDHESHTQISQ
FT                   PAARWPCTYEQAAAALSSATPVKVLLYRRVTQLQTLLYRGASPARLEAAIQRTLYVYNH
FT                   WTAKYQPFMQDCVANHELLPSRIQSWYVILDGHWHLAAMLLADVLESIDRDSYSDINHI
FT                   DLVTKLRLDNALAVSALARSSLRGQELDPGKASPMYRHFHDSLTEVAFLVEPWTVVLIH
FT                   SFAKAAYILLDCLDLDGQGNALAGYLQLRQNCNYCIRALQFLGRKSDMAALVAKDLERG
FT                   LNGKVDSFL"
     MADTRRRQNH SCDPCRKGKR RCDAPENRNE ANENGWVSCS NCKRWNKDCT FNWLSSQRSK        60
     AKGAAPRART KKARTATTTS EPSTSAATIP TPESDNHDAP PVINSHDALP SWTQGLLSHP       120
     GDLFDFSHSA IPANAEDAAN VQSDAPFPWD LAIPGDFSMG QQLEKPLSPL SFQAVLLPPH       180
     SPNTDDLIRE LEEQTTDPDS VTDTNSVQQV AQDGSLWSDR QSPLLPENSL CMASDSTARR       240
     YARSTMTKNL MRIYHDSMEN ALSCWLTEHN CPYSDQISYL PPKQRAEWGP NWSNRMCIRV       300
     CRLDRVSTSL RGRALSAEED KAAARALHLA IVAFASQWTQ HAQRGAGLNV PADIAADERS       360
     IRRNAWNEAR HALQHTTGIP SFRVIFANII FSLTQSVLDD DEQHGMGARL DKLLENDGAP       420
     VFLETANRQL YTFRHKFARM QRRGKAFNRL PGGSVASTFA GIFETPTPSS ESPQLDPVVA       480
     SEEHRSTLSL MFWLGIMFDT LSAAMYQRPL VVSDEDSQIS SASPPRRGAE TPINLDCWEP       540
     PRQVPSNQEK SDVWGDLFLR TSDSLPDHES HTQISQPAAR WPCTYEQAAA ALSSATPVKV       600
     LLYRRVTQLQ TLLYRGASPA RLEAAIQRTL YVYNHWTAKY QPFMQDCVAN HELLPSRIQS       660
     WYVILDGHWH LAAMLLADVL ESIDRDSYSD INHIDLVTKL RLDNALAVSA LARSSLRGQE       720
     LDPGKASPMY RHFHDSLTEV AFLVEPWTVV LIHSFAKAAY ILLDCLDLDG QGNALAGYLQ       780
     LRQNCNYCIR ALQFLGRKSD MAALVAKDLE RGLNGKVDSF L                           821
//

If you have problems or comments...

PBIL Back to PBIL home page