(data stored in ACNUC16935 zone)

EMBL: BN001307.PE88

BN001307.PE88        Location/Qualifiers
FT   CDS             join(238444..239195,239252..239561)
FT                   /locus_tag="ANIA_08977"
FT                   /old_locus_tag="AN8977.4"
FT                   /product="AkePPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARV3]"
FT                   /note="transcript_id=CADANIAT00007879"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007879"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007879"
FT                   /db_xref="GOA:Q5ARV3"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV3"
FT                   /protein_id="CBF84531.1"
FT                   /translation="MLFKNASFLFPLVLPLGALASSGPGNGTSGFMTFQPGFKAILGEH
FT                   PKLELLHENRTYPFAHEAPVYIPDTGDLFIVGNYQTPTGGQAIQISRMVPQKNGSYVRE
FT                   IIHPDIPMANGAINYNGGILFCDQGTKERPSSLIFMNATAPYETKVLLDSFYGRHFNSL
FT                   NDLDVHSDGSIWFTDPTYGYDQGFSMKPDLPNQVYRFNPKTGDVRVVADQIGQPNGIAF
FT                   SPDESIVYVTDTDAVWGNGDNDSTRPATIYAFDVKYYSGSPFLMNRRVFAYTDNGIPDG
FT                   VKTDTEGNVYAGCGDGVHVWSPAGVLLGKIQLPGTSANLAFAKPGEMFALNEYRLWKVT
FT                   LSQNVQGTILNEL"
     MLFKNASFLF PLVLPLGALA SSGPGNGTSG FMTFQPGFKA ILGEHPKLEL LHENRTYPFA        60
     HEAPVYIPDT GDLFIVGNYQ TPTGGQAIQI SRMVPQKNGS YVREIIHPDI PMANGAINYN       120
     GGILFCDQGT KERPSSLIFM NATAPYETKV LLDSFYGRHF NSLNDLDVHS DGSIWFTDPT       180
     YGYDQGFSMK PDLPNQVYRF NPKTGDVRVV ADQIGQPNGI AFSPDESIVY VTDTDAVWGN       240
     GDNDSTRPAT IYAFDVKYYS GSPFLMNRRV FAYTDNGIPD GVKTDTEGNV YAGCGDGVHV       300
     WSPAGVLLGK IQLPGTSANL AFAKPGEMFA LNEYRLWKVT LSQNVQGTIL NEL              353
//

If you have problems or comments...

PBIL Back to PBIL home page