(data stored in ACNUC16935 zone)

EMBL: BN001307.PE89

BN001307.PE89        Location/Qualifiers
FT   CDS             join(240294..240409,240458..240503,240535..240563,
FT                   240600..240712,240764..240999)
FT                   /locus_tag="ANIA_08976"
FT                   /old_locus_tag="AN8976.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007880"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007880"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007880"
FT                   /db_xref="GOA:Q5ARV4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV4"
FT                   /protein_id="CBF84533.1"
FT                   /translation="MTYNSGQETPATHTAPRCVREPASVPVQLVEGAWGLVVRPDLPMP
FT                   DAVIFYIHSNLLLSCLLSGAFILNIWGLILVWATLRSWESYGFTEESGDRKTHDSGLVS
FT                   RQPQFIIQYPQGSLKFVSDEPNMHVAIMTFKCLTFKEYASPTELLPVRRTYRPIVESPE
FT                   AGQIPQYQQPRPQNLG"
     MTYNSGQETP ATHTAPRCVR EPASVPVQLV EGAWGLVVRP DLPMPDAVIF YIHSNLLLSC        60
     LLSGAFILNI WGLILVWATL RSWESYGFTE ESGDRKTHDS GLVSRQPQFI IQYPQGSLKF       120
     VSDEPNMHVA IMTFKCLTFK EYASPTELLP VRRTYRPIVE SPEAGQIPQY QQPRPQNLG        179
//

If you have problems or comments...

PBIL Back to PBIL home page