(data stored in ACNUC16935 zone)

EMBL: BN001307.PE9

BN001307.PE9         Location/Qualifiers
FT   CDS             join(32617..32673,32730..33116,33171..33323)
FT                   /locus_tag="ANIA_09052"
FT                   /old_locus_tag="AN9052.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007801"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007801"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007801"
FT                   /db_xref="GOA:Q5ARM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM8"
FT                   /protein_id="CBF84386.1"
FT                   /translation="MRTIYITALIAFLALEAFGYPTDTDAVTEPAFPGYEDGTTTFQVV
FT                   PYPDADKITLSGTMQEVHAKILEINPIYEEDWKNVNNTYSKPEPRSDKPPLLNCDGRNG
FT                   YAKIDKINDGISYLRKFKLPPGLEGNTCQMVSCSYDSAISWCNALPTLRVLPSFDNIAD
FT                   GAQVILNWCQVDWDNVGGVLGHPDSWRVFVDKEKC"
     MRTIYITALI AFLALEAFGY PTDTDAVTEP AFPGYEDGTT TFQVVPYPDA DKITLSGTMQ        60
     EVHAKILEIN PIYEEDWKNV NNTYSKPEPR SDKPPLLNCD GRNGYAKIDK INDGISYLRK       120
     FKLPPGLEGN TCQMVSCSYD SAISWCNALP TLRVLPSFDN IADGAQVILN WCQVDWDNVG       180
     GVLGHPDSWR VFVDKEKC                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page